MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1245_Other_P1_B9.mgf
Database : S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues)
Timestamp : 24 Jun 2025 at 21:21:15 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,728

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 16)


Page: 1 2 Next 

-1

Accession Score Description
1 Q9FD70_ENTFL 101 Acetyl-CoA acetyltransferase/HMG-CoA reductase OS=Enterococcus faecalis GN=mvaE PE=3 SV=1
Score Mass Matches Sequences emPAI
1.1 Q9FD70_ENTFL 101 86614 2 (2) 2 (2) 0.08
Acetyl-CoA acetyltransferase/HMG-CoA reductase OS=Enterococcus faecalis GN=mvaE PE=3 SV=1
1 sameset of Q9FD70_ENTFL
Q835L3_ENTFA 101 86643 2 (2) 2 (2) 0.08
Acetyl-CoA acetyltransferase/hydroxymethylglutaryl-CoA reductase, degradative OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_1364 PE=3 SV=1

-2 peptide matches (2 non-duplicate, 0 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
D:\Xcalibur\Data\Yan\PRT1245 redo\PRT1245_Other_P1_B9.raw

Score > 20 indicates identity

4403   990.1824 2967.5254 2967.4713 18.2 0 90 5.8e-009 -1Score > 20 indicates identity U R.NQLTTEEIDLYEINEAFAATSIVVQR.E + Deamidated (NQ)
18.2 0 68 8.1e-007 2 R.NQLTTEEIDLYEINEAFAATSIVVQR.E + Deamidated (NQ)
18.2 0 68 8.1e-007 2 R.NQLTTEEIDLYEINEAFAATSIVVQR.E + Deamidated (NQ)
18.2 0 55 1.7e-005 4 R.NQLTTEEIDLYEINEAFAATSIVVQR.E + Deamidated (NQ)
4644   1138.3501 4549.3713 4549.2864 18.7 1 29 0.0027 +1Score > 16 indicates identity U K.TVFKEDGTVTAGNASTINDGASALIIASQEYAEAHGLPYLAIIR.D + 2 Deamidated (NQ)

+2

Accession Score Description
1 PGK_YEAST 98 Phosphoglycerate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGK1 PE=1 SV=2

+3

Accession Score Description
1 ENO1_YEAST 45 Enolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENO1 PE=1 SV=3

+4

Accession Score Description
1 PUS9_YEAST 36 tRNA pseudouridine(32) synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUS9 PE=1 SV=1

+5

Accession Score Description
1 BRR6_YEAST 30 Nucleus export protein BRR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR6 PE=1 SV=1

+6

Accession Score Description
1 COG8_YEAST 27 Conserved oligomeric Golgi complex subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COG8 PE=1 SV=1

+7

Accession Score Description
1 APE2_YEAST 24 Aminopeptidase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE2 PE=1 SV=4

+8

Accession Score Description
1 RPF1_YEAST 23 Ribosome production factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF1 PE=1 SV=1

+9

Accession Score Description
1 B211p2_002|NRPSb 22 OS=Anaeromyces robustus OX=1754192 PE=2 SV=1

+10

Accession Score Description
1 AVO2_YEAST 22 Target of rapamycin complex 2 subunit AVO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVO2 PE=1 SV=1
Page: 1 2 Next 

Not what you expected? Try the select summary.