MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1258_JBEI_Tube1_A1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,568

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4077)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 41 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4144 1091.5541 3271.6405 3271.6390 0.45 1 0 3.3 +1Score > 18 indicates identity IVMMSSVTGDMVADPGETAYALTKAAIVGLTK + 2 Oxidation (M)
2710 402.5502 1204.6288 1204.6162 10.5 0 0 0.95 +1Score > 20 indicates identity
Score > 13 indicates homology		 MPNLLPFQTK + Deamidated (NQ); Oxidation (M)
4406 834.8521 4169.2241 4169.2010 5.55 1 0 0.95 +1Score > 13 indicates identity GAALIIAPYTMPLPLFSPPLIYTDLTLTTHQQEQIRK + 3 Deamidated (NQ); Oxidation (M)
3480 1087.5486 2173.0826 2173.0408 19.2 1 0 4.8 +1Score > 20 indicates identity MPAHRFAINLSPTSVCQAR + 2 Deamidated (NQ); Oxidation (M)
4089 1036.8525 3107.5357 3107.5307 1.59 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 YGAIDSPALPAFVEAMNVVLTDAMAEPKR + 2 Oxidation (M)
4317 617.9987 3701.9485 3701.8875 16.5 1 0 1.4 +1Score > 14 indicates identity LKPQNNLPELISGWRGELMAEALHNLLQEYPQ + Deamidated (NQ)
4297 617.9968 3701.9371 3701.8677 18.7 1 0 1.7 +1Score > 15 indicates identity ELLDQLNKQLGNQLMMAINLQINQQQLMSVSK + 3 Deamidated (NQ); Oxidation (M)
3714 616.8267 2463.2777 2463.2423 14.4 1 0 3.5 +1Score > 18 indicates identity NIIQLVDAGMKVGMPTMAVTGVGK + 2 Deamidated (NQ); 2 Oxidation (M)
3724 826.0701 2475.1885 2475.2129 -9.87 0 0 4.8 +1Score > 20 indicates identity TVAVTEQTIDWNNNGTLVQITR + 3 Deamidated (NQ)
3506 734.7325 2201.1757 2201.2168 -18.7 1 0 2.7 +1Score > 17 indicates identity LLAKQIDQPLHLGITEAGGAR + Deamidated (NQ)
3798 867.4610 2599.3612 2599.3493 4.56 1 0 3.4 +1Score > 18 indicates identity DVQLEQELLEEAQKLGLGAQFGGK
4516 997.5137 4982.5321 4982.4509 16.3 0 0 1.6 +1Score > 15 indicates identity ATTQQSGFAPAASPLASTIVQTPDDAIVAGFTSIPSQGDNMPAYHARPK
2633 382.8490 1145.5252 1145.5387 -11.8 0 0 1.9 +1Score > 16 indicates identity QQIEDPIMR + Deamidated (NQ); Oxidation (M)
2733 409.5775 1225.7107 1225.7143 -2.93 1 0 2 +1Score > 16 indicates identity VGRIDAILVDR
4094 1047.8403 3140.4991 3140.4794 6.26 0 0 4.5 +1Score > 19 indicates identity EGNPIESQFNYTLEAAQSSLPMTPMTLR + Oxidation (M)
2838 332.8976 1327.5613 1327.5822 -15.7 1 0 1.2 +1Score > 13 indicates identity VKECEEMMIK + 2 Oxidation (M)
2847 445.2655 1332.7747 1332.7613 10.0 1 0 0.97 +1Score > 13 indicates identity VVALTGSSGKTSVK
2917 709.3892 1416.7638 1416.7897 -18.3 1 0 3.1 +1Score > 18 indicates identity LLMQLKENGLIK + 2 Deamidated (NQ); Oxidation (M)
4033 982.4748 2944.4026 2944.4119 -3.17 1 0 4.1 +1Score > 19 indicates identity QLLEMLEMVTDMESTYLTKVDVEAR + Deamidated (NQ)
3030 759.3840 1516.7534 1516.7270 17.4 1 0 4.5 +1Score > 19 indicates identity NLADGKGAADGTNWK
4477 754.1908 4519.1011 4519.0411 13.3 1 0 2.4 +1Score > 16 indicates identity LRYNNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGR + Deamidated (NQ)
2909 352.1897 1404.7297 1404.7109 13.4 1 0 4.3 +1Score > 19 indicates identity NENNEIFITRR
3072 517.6051 1549.7935 1549.7671 17.0 1 0 3.6 +1Score > 18 indicates identity CTPEQTLRYLNR
2655 388.5359 1162.5859 1162.6016 -13.5 1 0 4.7 +1Score > 19 indicates identity KLAQALESMR + Deamidated (NQ); Oxidation (M)
3464 716.0544 2145.1414 2145.1317 4.50 1 0 2.9 +1Score > 17 indicates identity ALLSSKGVSFQELPIDGNAAK + Deamidated (NQ)
4391 690.5390 4137.1903 4137.1633 6.53 1 0 0.98 +1Score > 13 indicates identity ETTFTGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGR + 2 Deamidated (NQ)
3327 947.9976 1893.9806 1893.9618 9.94 1 0 4.2 +1Score > 19 indicates identity TFVCANLAAVISQTNKR + 2 Deamidated (NQ)
3748 837.0759 2508.2059 2508.1743 12.6 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 IEAGEFNIQQMDVQTYFFRR + Deamidated (NQ); Oxidation (M)
4474 751.6922 4504.1095 4504.0607 10.8 1 0 2.6 +1Score > 17 indicates identity IYLIEMESDDPANALPSTDKAVSDNDDMMILVVDDHPINR + Deamidated (NQ); 2 Oxidation (M)
2792 641.8594 1281.7042 1281.6829 16.6 1 0 1.7 +1Score > 15 indicates identity RHEAWITLEK
3648 790.4107 2368.2103 2368.1845 10.9 1 0 4.6 +1Score > 19 indicates identity ANYYRCLQTLLLLAQEEDR
3026 758.9294 1515.8442 1515.8297 9.61 1 0 2.1 +1Score > 16 indicates identity GSVAEWAVKTVIEK
3048 766.8873 1531.7600 1531.7817 -14.1 0 0 4.4 +1Score > 19 indicates identity TPVGNTAAICIYPR
3947 930.4887 2788.4443 2788.4025 15.0 1 0 3.1 +1Score > 17 indicates identity GSGNSVAALLGNSNGNLKLLMNDGLVSR + 2 Deamidated (NQ); Oxidation (M)
3140 411.4630 1641.8229 1641.8508 -17.0 1 0 3.6 +1Score > 18 indicates identity MTKHTLEQLAADLR + Oxidation (M)
3562 764.4031 2290.1875 2290.1845 1.30 0 0 3.2 +1Score > 18 indicates identity ETIEDVLEPYLIQQGFLQR
4323 938.2072 3748.7997 3748.8406 -10.9 1 0 3.3 +1Score > 18 indicates identity AEYLLSLHGFDLASEQHTVRDTAFLMEQLELR + Deamidated (NQ); Oxidation (M)
1 300.0302 299.0229
2 300.0308 299.0235
3 300.0313 299.0240
4 300.1815 299.1742
5 300.1816 299.1743
6 300.1821 299.1748
7 300.2560 299.2487
8 300.7141 299.7068
9 301.0591 300.0518
10 301.0965 300.0892
11 301.1051 300.0978
12 301.1150 300.1077
13 301.1298 300.1225
14 301.1628 300.1555
15 301.2211 300.2138
16 301.8892 300.8819
17 301.8896 300.8823
18 301.8898 300.8825
19 301.8899 300.8826
20 301.8901 300.8828
21 301.8902 300.8829
22 301.8904 300.8831
23 301.8905 300.8832
24 301.8907 300.8834
25 301.8907 300.8834
26 301.8909 300.8836
27 301.8909 300.8836
28 301.8909 300.8836
29 302.0467 301.0394
30 302.1967 301.1894
31 302.1972 301.1899
32 302.1973 301.1900
33 302.1976 301.1903
34 302.1978 301.1905
35 302.2338 301.2265
36 302.2343 301.2270
37 302.2348 301.2275
38 302.2350 301.2277
39 302.8701 301.8628
40 303.0742 302.0669
41 303.0746 302.0673
42 303.0849 302.0776
43 303.0854 302.0781
44 303.1031 302.0958
45 303.1207 302.1134
46 303.1209 302.1136
47 303.1211 302.1138
48 303.1217 302.1144
49 303.1219 302.1146
50 303.1221 302.1148
51 303.1222 302.1149
52 303.1226 302.1153
53 303.1781 302.1708
54 303.1784 302.1711
55 303.2144 302.2071
56 303.8839 302.8766
57 303.8843 302.8770
58 303.8843 302.8770
59 303.8844 302.8771
60 303.8845 302.8772
61 303.8846 302.8773
62 303.8847 302.8774
63 303.8847 302.8774
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 41 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/