MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1258_JBEI_Tube1_A1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:29 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,568

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 4077)


Page: Previous 1 2 3 4 5 6 7 8  41 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3221 572.9854 1715.9344 1715.9392 -2.84 1 3 1.3 +1Score > 16 indicates identity ILHEVVAGATLMKYR + Oxidation (M)
3023 506.2619 1515.7639 1515.7933 -19.4 0 3 2.3 +1Score > 19 indicates identity LIAQLDPVGTAFNR + 2 Deamidated (NQ)
2836 331.9166 1323.6373 1323.6614 -18.2 1 3 1.7 +1Score > 17 indicates identity MIWIMTMARR + Oxidation (M)
3428 696.3345 2085.9817 2086.0119 -14.5 1 3 1.8 +1Score > 18 indicates identity GAQPSVPWREEIDAFLDR + Deamidated (NQ)
3433 525.0032 2095.9837 2096.0071 -11.2 0 3 2.4 +1Score > 19 indicates identity VIPGFMIQGGGFTEQMQQK + Deamidated (NQ)
2769 631.8137 1261.6128 1261.6350 -17.5 0 3 2.3 +1Score > 19 indicates identity SLCNVGFGRPR
3366 664.0010 1988.9812 1988.9738 3.70 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
QDYTVVIVTHNMQQAAR + Oxidation (M)
2594 540.7793 1079.5440 1079.5248 17.9 0 3 2 +1Score > 18 indicates identity NGVGVTVYDR + Deamidated (NQ)
3135 409.9513 1635.7761 1635.8046 -17.4 0 3 2.4 +1Score > 19 indicates identity SYPFIFLSGDTHPR
2368 406.6961 811.3776 811.3898 -15.0 0 3 0.72 +1Score > 14 indicates identity QYCTLK
2607 549.8128 1097.6110 1097.6080 2.73 0 3 1.1 +1Score > 16 indicates identity LPSQNIAVVR + 2 Deamidated (NQ)
4302 617.9974 3701.9407 3701.8875 14.4 1 3 0.88 +1Score > 15 indicates identity LKPQNNLPELISGWRGELMAEALHNLLQEYPQ + Deamidated (NQ)
2537 338.7968 1013.3686 1013.3794 -10.6 0 3 0.54 +1Score > 13 indicates identity MEMTNAQR + 2 Deamidated (NQ); 2 Oxidation (M)
3089 791.9000 1581.7854 1581.7899 -2.83 1 3 2.2 +1Score > 19 indicates identity RSDAEPHYLPQLR + Deamidated (NQ)
4202 699.7415 3493.6711 3493.6163 15.7 1 3 2.5 +1Score > 19 indicates identity LIAPGADGVKMQCDLLSCQNAGWQGVTLNTTR + 4 Deamidated (NQ); Oxidation (M)
3095 796.8979 1591.7812 1591.7637 11.0 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
VRIEAQMHGGGHER + Oxidation (M)
3128 541.3099 1620.9079 1620.8770 19.1 1 3 0.74 +1Score > 14 indicates identity AILDRMAAQIPHLR + Deamidated (NQ); Oxidation (M)
3191 842.4281 1682.8416 1682.8185 13.7 1 3 2.4 +1Score > 19 indicates identity SSDGQLMFQVNKLSK + 2 Deamidated (NQ)
3591 771.3882 2311.1428 2311.1226 8.71 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
AVESVGGQLLITADHGNAEQMR + Oxidation (M)
2726 305.4053 1217.5921 1217.5838 6.82 1 3 2.8 +1Score > 19 indicates identity MMFWRIFR + 2 Oxidation (M)
2705 401.5210 1201.5412 1201.5186 18.8 0 3 1.2 +1Score > 16 indicates identity QQFQQMGYR + Deamidated (NQ); Oxidation (M)
2766 420.8747 1259.6023 1259.6106 -6.58 0 3 1.8 +1Score > 18 indicates identity NLLGQQNQTSR + 2 Deamidated (NQ)
3300 928.4524 1854.8902 1854.9258 -19.1 1 3 2.7 +1Score > 19 indicates identity VNVAMNQTRINHLAVR + 4 Deamidated (NQ); Oxidation (M)
4306 529.8563 3701.9432 3701.8875 15.0 1 2 0.9 +1Score > 15 indicates identity LKPQNNLPELISGWRGELMAEALHNLLQEYPQ + Deamidated (NQ)
4169 846.9099 3383.6105 3383.6047 1.71 1 2 2 +1Score > 18 indicates identity MPNVDVVGEMVNTMSASRSYQANVEVLNTVK + 2 Deamidated (NQ)
2384 837.4236 836.4163 836.4140 2.72 1 2 2.2 +1Score > 18 indicates identity SARFDNK
3441 703.6793 2108.0161 2108.0572 -19.5 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
AATLQDQAGGPPLNPIEMASK
3787 858.4116 2572.2130 2572.1978 5.91 0 2 2.3 +1Score > 19 indicates identity MAGAGNYYPPTVLANVTPEMTAFR + 2 Deamidated (NQ)
3636 1176.5881 2351.1616 2351.1441 7.48 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
VIAAGANVVRMNFSHGSPEDHK + Oxidation (M)
3206 566.6211 1696.8415 1696.8243 10.1 0 2 2.6 +1Score > 19 indicates identity LIQDFDGIFNQTMR
3526 745.7430 2234.2072 2234.1921 6.73 1 2 1.2 +1Score > 16 indicates identity IGSIGKLYWFMPPSANLALR + Deamidated (NQ)
2588 357.8633 1070.5681 1070.5720 -3.67 1 2 1.6 +1Score > 17 indicates identity TVSSHKGNIK + Deamidated (NQ)
4193 865.2040 3456.7869 3456.7203 19.3 0 2 1.8 +1Score > 17 indicates identity MGVKPGGNIALLACAGPMGIGAIDYAINGGIQPSR + 2 Deamidated (NQ); Oxidation (M)
4154 830.3981 3317.5633 3317.5258 11.3 1 2 2.3 +1Score > 19 indicates identity QLYDDLLRNAGTGQDNLTHQMHLQETFR + 4 Deamidated (NQ)
2195 301.6985 601.3824 601.3799 4.27 0 2 1 +1Score > 15 indicates identity LAASLK
2609 551.8109 1101.6072 1101.5965 9.80 1 2 1.8 +1Score > 17 indicates identity QVLNMPTKR + Oxidation (M)
3778 855.4092 2563.2058 2563.2442 -15.0 1 2 2.7 +1Score > 19 indicates identity EFIDSSQPPLSEVNQEKFNNIK + Deamidated (NQ)
2314 746.4130 745.4057 745.4156 -13.3 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
VLEVMR
3344 647.6650 1939.9732 1939.9448 14.6 1 2 2.6 +1Score > 19 indicates identity QYLELMQKVLDEGTQK + 2 Deamidated (NQ); Oxidation (M)
4037 982.4788 2944.4146 2944.4099 1.60 1 2 2.7 +1Score > 19 indicates identity EWYFTTEESRILLVNNMEEILCR
3059 385.6935 1538.7449 1538.7300 9.68 0 2 2.7 +1Score > 19 indicates identity MIAHHFGTDEIPR + Oxidation (M)
3882 908.4792 2722.4158 2722.4442 -10.4 1 2 2.3 +1Score > 18 indicates identity WFILQATSPAANVLETVRGLLQHR + 3 Deamidated (NQ)
3924 554.8799 2769.3631 2769.3358 9.88 1 2 2.6 +1Score > 19 indicates identity NVVVLAGNHEINFNGNYTARLANHK + 5 Deamidated (NQ)
2456 314.8637 941.5693 941.5658 3.68 0 2 1 +1Score > 15 indicates identity GSLLLVGQR
3496 731.6922 2192.0548 2192.0136 18.8 1 2 2.8 +1Score > 19 indicates identity MALNALDGMLARECNQQTR + Deamidated (NQ)
4177 856.4333 3421.7041 3421.6500 15.8 0 2 2.6 +1Score > 19 indicates identity DVNDNAQTLANLSNALFDAGVMPYYLHVLDK + Deamidated (NQ)
3794 862.7426 2585.2060 2585.1955 4.05 0 2 2.8 +1Score > 19 indicates identity EFASVVMSLQENTPKPQNASAYR + 3 Deamidated (NQ); Oxidation (M)
4030 731.8391 2923.3273 2923.3341 -2.32 1 2 1.7 +1Score > 17 indicates identity AHVGDEEHRAMLEQQAWIGLMDQAR + Deamidated (NQ); 2 Oxidation (M)
4462 898.6224 4488.0756 4488.0658 2.18 1 2 1.8 +1Score > 17 indicates identity IYLIEMESDDPANALPSTDKAVSDNDDMMILVVDDHPINR + Deamidated (NQ); Oxidation (M)
3235 866.9443 1731.8740 1731.8436 17.6 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology
IIADIIAWCSGNMPR + Oxidation (M)
4016 724.0978 2892.3621 2892.3898 -9.58 1 2 2.6 +1Score > 19 indicates identity IVMGAMHLNLETREDGGAAVAAFYAER + Deamidated (NQ)
3729 620.8196 2479.2493 2479.2815 -13.0 0 2 2.7 +1Score > 19 indicates identity TIFTVGAVVLATCLLSGCVNEQK
3821 885.1332 2652.3778 2652.3871 -3.52 1 2 1.9 +1Score > 17 indicates identity ISLQQRIPGVSIQGASQADELWQK + Deamidated (NQ)
3683 606.5944 2422.3485 2422.3631 -6.02 1 2 0.63 +1Score > 13 indicates identity KHRPAKPLAVMLPVADGLPDAAR
3583 1152.0648 2302.1150 2302.0722 18.6 1 2 0.67 +1Score > 20 indicates identity
Score > 13 indicates homology
FATEGMMQVLADEYQQRLR + Deamidated (NQ); Oxidation (M)
3009 501.2828 1500.8266 1500.8413 -9.79 1 2 2.3 +1Score > 18 indicates identity IGYPVIIKASGGGGGR
4331 639.1702 3828.9775 3828.9360 10.8 1 2 1.4 +1Score > 16 indicates identity MSASLKNQQGFSLPEVMLAMVLMVMIVTALSGFQR + 2 Deamidated (NQ)
4009 962.8077 2885.4013 2885.3866 5.10 1 2 3 +1Score > 19 indicates identity QGSVVFADFETVQGQSAIMNITRSDGK + Deamidated (NQ)
3610 777.4028 2329.1866 2329.2141 -11.8 0 2 3 +1Score > 19 indicates identity VDVLQPTLWATMVSLAEVWR + Oxidation (M)
3384 1012.5250 2023.0354 2023.0659 -15.1 0 2 2.5 +1Score > 18 indicates identity MEQSLIPQTPVLPLTAQR + 2 Deamidated (NQ)
3925 924.1364 2769.3874 2769.4218 -12.4 0 2 3 +1Score > 19 indicates identity IMDLQSAQQLGEIAAAVGLAQNLGALR + 3 Deamidated (NQ); Oxidation (M)
3275 598.9803 1793.9191 1793.8948 13.5 0 2 2.6 +1Score > 19 indicates identity DEIQFYATGARPDLAK
3393 1030.5270 2059.0394 2059.0157 11.6 1 2 0.94 +1Score > 20 indicates identity
Score > 14 indicates homology
VVASMQDPNPQVAGRGLYR + 2 Deamidated (NQ)
4454 739.1829 4429.0537 4429.1393 -19.3 1 2 2.1 +1Score > 18 indicates identity INIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTR + Oxidation (M)
3518 558.0256 2228.0733 2228.0491 10.8 0 2 3 +1Score > 19 indicates identity HINNITGESGTNVGGMLENVR + Deamidated (NQ); Oxidation (M)
4071 763.6128 3050.4221 3050.4492 -8.90 0 2 2 +1Score > 17 indicates identity NIAMVFQNYALYPHMTVYDNMAFGLK
4487 758.0163 4542.0541 4542.1128 -12.9 0 2 1 +1Score > 14 indicates identity GTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDK + Deamidated (NQ); 2 Oxidation (M)
2656 388.5365 1162.5877 1162.5903 -2.29 0 2 0.88 +1Score > 20 indicates identity
Score > 14 indicates homology
MNIQALLSEK + Deamidated (NQ); Oxidation (M)
2763 419.2076 1254.6010 1254.6245 -18.7 0 2 2 +1Score > 17 indicates identity SEGFGITLFER
3862 898.4410 2692.3012 2692.3009 0.094 1 2 2.9 +1Score > 19 indicates identity NQDMLLSVLDLEKMTVDDIMVPR + 2 Deamidated (NQ); Oxidation (M)
3545 754.7241 2261.1505 2261.1918 -18.3 1 2 2.6 +1Score > 19 indicates identity LAMYEIGLNIFIKSPFSFR + Oxidation (M)
2425 447.7260 893.4374 893.4389 -1.59 1 2 2.6 +1Score > 18 indicates identity MTNRISR + Deamidated (NQ); Oxidation (M)
3643 788.4195 2362.2367 2362.2645 -11.8 1 2 2.3 +1Score > 18 indicates identity QKIVIVANGAPYGSESLFNSLR
2589 536.7864 1071.5582 1071.5495 8.18 1 2 3.1 +1Score > 19 indicates identity DIARNAMPGK
2621 558.3099 1114.6052 1114.6234 -16.3 0 2 3.1 +1Score > 19 indicates identity DGVALTIADIK
2775 638.3499 1274.6852 1274.6772 6.35 1 2 2.9 +1Score > 19 indicates identity TALNFPWTRGI
3863 898.4442 2692.3108 2692.3009 3.66 1 2 3.4 +1Score > 19 indicates identity NQDMLLSVLDLEKMTVDDIMVPR + 2 Deamidated (NQ); Oxidation (M)
3544 754.3876 2260.1410 2260.0986 18.7 1 2 2.9 +1Score > 19 indicates identity VNAFFAPDYAGIIQGMRFNK + 2 Deamidated (NQ)
3546 755.4016 2263.1830 2263.1583 10.9 1 2 2.6 +1Score > 18 indicates identity TVEVVKNAIETADGALDLYNK + Deamidated (NQ)
2819 436.5767 1306.7083 1306.7146 -4.84 1 2 1.5 +1Score > 16 indicates identity QVFPLTGRYAR
3322 947.4973 1892.9800 1892.9553 13.1 1 2 3.2 +1Score > 19 indicates identity EQLEMEIDKFTIIQR + Deamidated (NQ)
3760 845.0590 2532.1552 2532.1399 6.02 0 2 2.5 +1Score > 18 indicates identity VNYLLLSGDNALQSYNEPMTMR + 4 Deamidated (NQ)
4254 897.4817 3585.8977 3585.8278 19.5 1 2 1.6 +1Score > 16 indicates identity NKQSGMTLLEVLLAMSIFTAVALTLMSSMQGQR + Deamidated (NQ); Oxidation (M)
2615 370.2009 1107.5809 1107.5746 5.62 0 1 3.1 +1Score > 19 indicates identity MLAFLNQVR + Deamidated (NQ); Oxidation (M)
4278 729.5929 3642.9281 3642.8830 12.4 1 1 1.2 +1Score > 15 indicates identity EMVLNLFFIFLVLVGVGIWMQVSGGDSKETASR + Deamidated (NQ)
3737 624.5616 2494.2173 2494.2299 -5.06 1 1 3.4 +1Score > 19 indicates identity ALEALSAEDGHDDVGQRLESLLR + Deamidated (NQ)
4457 739.3493 4430.0521 4430.1233 -16.1 1 1 2.3 +1Score > 17 indicates identity INIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTR + Deamidated (NQ); Oxidation (M)
4392 690.5391 4137.1909 4137.1633 6.67 1 1 0.72 +1Score > 13 indicates identity ETTFTGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGR + 2 Deamidated (NQ)
3333 477.0156 1904.0333 1904.0077 13.4 0 1 1.4 +1Score > 15 indicates identity GLQFLDLIQEGNIGLMK + Oxidation (M)
3285 605.3413 1813.0021 1813.0097 -4.23 1 1 1 +1Score > 14 indicates identity AKATAYILEHVEISIR
2583 533.7449 1065.4752 1065.4727 2.42 0 1 1.3 +1Score > 15 indicates identity YQSASPEQR + Deamidated (NQ)
2659 585.3174 1168.6202 1168.6339 -11.7 0 1 1.8 +1Score > 16 indicates identity LIAAALPQDEK + Deamidated (NQ)
3539 563.2774 2249.0805 2249.1038 -10.4 1 1 0.75 +1Score > 20 indicates identity
Score > 13 indicates homology
FNIHDDQKMVLDFLLQEK + Deamidated (NQ); Oxidation (M)
3731 620.8219 2479.2585 2479.2815 -9.28 0 1 2.8 +1Score > 18 indicates identity TIFTVGAVVLATCLLSGCVNEQK
3738 832.4131 2494.2175 2494.2299 -4.99 1 1 3.5 +1Score > 19 indicates identity ALEALSAEDGHDDVGQRLESLLR + Deamidated (NQ)
2548 342.1569 1023.4489 1023.4655 -16.2 0 1 1 +1Score > 14 indicates identity VSQASMTQR + Deamidated (NQ); Oxidation (M)
3011 501.9209 1502.7409 1502.7551 -9.49 1 1 3.3 +1Score > 19 indicates identity AAEKIHMTASPFGK + Oxidation (M)
4320 741.5969 3702.9481 3702.9733 -6.81 1 1 1.4 +1Score > 15 indicates identity IVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIR
2542 509.7461 1017.4776 1017.4702 7.34 0 1 2.7 +1Score > 18 indicates identity MPISWNDR
3966 935.4595 2803.3567 2803.3064 17.9 1 1 3.4 +1Score > 19 indicates identity GFGLLQLDRDFSHYQDIMGWYNK + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8  41 Next 

Not what you expected? Try the select summary.