MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1258_JBEI_Tube1_A1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:29 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,568

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4077)


Page: Previous 1 2 3 4 5 6 7  41 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2297 738.3876 737.3803 737.3820 -2.28 1 6 0.48 +1Score > 15 indicates identity YRASNK
2233 647.3447 646.3374 646.3286 13.7 1 6 1.2 +1Score > 19 indicates identity KENEK
2264 348.6831 695.3516 695.3425 13.2 0 6 0.55 +1Score > 16 indicates identity MNFIR + Oxidation (M)
2282 362.7097 723.4048 723.3989 8.19 0 6 0.28 +1Score > 13 indicates identity MIFGLK + Oxidation (M)
2303 371.2301 740.4456 740.4432 3.28 0 6 0.26 +1Score > 13 indicates identity VANLVPK + Deamidated (NQ)
2307 372.2206 742.4266 742.4126 18.9 0 6 0.69 +1Score > 17 indicates identity FAHAVAK
2921 712.3608 1422.7070 1422.7103 -2.27 0 6 1 +1Score > 20 indicates identity
Score > 18 indicates homology
ELGIQADVANVHR + 2 Deamidated (NQ)
2698 401.1871 1200.5395 1200.5445 -4.17 0 6 0.41 +1Score > 14 indicates identity DPNVQMVPER + Deamidated (NQ); Oxidation (M)
3084 790.9184 1579.8222 1579.7916 19.4 1 6 0.97 +1Score > 18 indicates identity DTPILTFMNKLDR + Deamidated (NQ); Oxidation (M)
3246 581.6433 1741.9081 1741.8821 14.9 0 6 1.3 +1Score > 19 indicates identity LNLEGLEHIAAFMQR + Deamidated (NQ)
2708 602.8321 1203.6496 1203.6281 17.9 0 5 0.83 +1Score > 17 indicates identity ELMQGSLASLR
3929 925.8365 2774.4877 2774.5192 -11.3 1 5 0.64 +1Score > 16 indicates identity DDLRHATLVALPVPGHGAGEPIGILTR
2732 307.1487 1224.5657 1224.5478 14.6 1 5 0.71 +1Score > 16 indicates identity MKNVGDLMQR + 2 Deamidated (NQ); 2 Oxidation (M)
2441 457.7395 913.4644 913.4505 15.3 0 5 0.61 +1Score > 16 indicates identity NVPQQVAR + 3 Deamidated (NQ)
3049 767.3773 1532.7400 1532.7219 11.8 1 5 1.3 +1Score > 19 indicates identity RDPNQTEFAQAVR + 2 Deamidated (NQ)
3172 836.4313 1670.8480 1670.8700 -13.1 1 5 1.1 +1Score > 18 indicates identity QTGGVVDLSNLERQR
4450 739.1823 4429.0501 4429.0174 7.39 1 5 0.93 +1Score > 18 indicates identity AEIIVYPDAGHAFNADYRPSYHAASAEDGWQRMLEWFK + 2 Deamidated (NQ); Oxidation (M)
3779 856.4304 2566.2694 2566.2461 9.08 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
IAIECHSCIQWLTPALENFHK
3719 822.7731 2465.2975 2465.2737 9.64 1 5 0.88 +1Score > 17 indicates identity GLDAILVPGGFGYRGVEGMITTAR + Oxidation (M)
2617 557.2987 1112.5828 1112.5713 10.4 0 5 0.66 +1Score > 16 indicates identity TNNPLIPQSK + 2 Deamidated (NQ)
2322 383.1871 764.3596 764.3561 4.67 0 5 1 +1Score > 18 indicates identity MGIPMGK + 2 Oxidation (M)
3227 573.9741 1718.9005 1718.9203 -11.5 1 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
VNKTLEYLTISPNAR + Deamidated (NQ)
4447 739.1774 4429.0207 4429.0174 0.75 1 5 0.85 +1Score > 17 indicates identity AEIIVYPDAGHAFNADYRPSYHAASAEDGWQRMLEWFK + 2 Deamidated (NQ); Oxidation (M)
4167 843.1699 3368.6505 3368.6567 -1.84 0 5 1.3 +1Score > 19 indicates identity AMQQLLDLPQPPTAVFCHSDVMALGALSQAK + 2 Oxidation (M)
3656 475.4744 2372.3356 2372.3355 0.033 1 5 0.31 +1Score > 13 indicates identity ILSKLGVTTSWFDPLIGADIVK
4284 916.4769 3661.8785 3661.8596 5.16 1 5 0.93 +1Score > 17 indicates identity FIQIHLEMEDSLPLVQAHMVADQVEQAILRR + Deamidated (NQ); 2 Oxidation (M)
3343 485.2403 1936.9321 1936.9088 12.0 1 5 1.1 +1Score > 18 indicates identity NLKENQPLFDMTINDK + 2 Deamidated (NQ); Oxidation (M)
4207 878.4324 3509.7005 3509.6521 13.8 1 5 1.5 +1Score > 19 indicates identity QNDNAPCPPGWQLSLPAARAFILGDEAQNISR + 4 Deamidated (NQ)
2614 554.7975 1107.5804 1107.5746 5.25 0 5 1.4 +1Score > 19 indicates identity VNLYALMQR + Deamidated (NQ)
3282 604.2891 1809.8455 1809.8423 1.75 0 5 1.2 +1Score > 18 indicates identity AMLTLMLQAMGQADAGR + Deamidated (NQ); 2 Oxidation (M)
4517 1000.9050 4999.4886 4999.4324 11.2 1 5 0.66 +1Score > 16 indicates identity GEIFHFNPGSVSIPKGGNPASYGMLDNDVLSVIALNDQSIIAQVAINP + 5 Deamidated (NQ); Oxidation (M)
3594 771.7134 2312.1184 2312.0954 9.92 1 5 1.7 +1Score > 19 indicates identity DSIGGIVSSRCTNEEGYLVQK + Deamidated (NQ)
2353 395.7198 789.4250 789.4093 20.0 1 5 1.2 +1Score > 18 indicates identity SRSNGLR + Deamidated (NQ)
2637 1149.5927 1148.5854 1148.5859 -0.45 1 5 1 +1Score > 20 indicates identity
Score > 17 indicates homology
AETIRLMGDK + Oxidation (M)
2651 579.7988 1157.5830 1157.5677 13.3 0 5 1.3 +1Score > 18 indicates identity SSDNVPDVGIR
3926 924.1385 2769.3937 2769.4218 -10.2 0 5 1.7 +1Score > 19 indicates identity IMDLQSAQQLGEIAAAVGLAQNLGALR + 3 Deamidated (NQ); Oxidation (M)
2906 352.1888 1404.7261 1404.7282 -1.52 0 5 1.6 +1Score > 19 indicates identity LSMAQSALSQIVR + 2 Deamidated (NQ)
3542 752.3885 2254.1437 2254.1126 13.8 0 5 1.6 +1Score > 19 indicates identity IIGGYDFILCSNVLSAVPCR + Deamidated (NQ)
3723 824.1037 2469.2893 2469.2434 18.6 1 5 1.1 +1Score > 17 indicates identity HPQYNQRTIQNDIMLLQLSR + 2 Deamidated (NQ)
3320 947.4924 1892.9702 1892.9414 15.2 1 4 1.8 +1Score > 19 indicates identity AYNLTSVRDPNEMLVR + Oxidation (M)
2972 370.9328 1479.7021 1479.6841 12.1 1 4 1.2 +1Score > 18 indicates identity NEDVKQAFDSAVR + 2 Deamidated (NQ)
2334 774.4737 773.4664 773.4647 2.26 1 4 0.63 +1Score > 15 indicates identity KLLDSAK
2605 549.8087 1097.6028 1097.6193 -15.0 0 4 0.74 +1Score > 16 indicates identity IVSRPEELR
4168 677.5297 3382.6121 3382.6207 -2.54 1 4 1.6 +1Score > 19 indicates identity MPNVDVVGEMVNTMSASRSYQANVEVLNTVK + Deamidated (NQ)
2230 645.3592 644.3519 644.3493 4.04 0 4 0.7 +1Score > 21 indicates identity
Score > 15 indicates homology
EQLAGK
3147 551.5893 1651.7461 1651.7492 -1.87 0 4 1.1 +1Score > 17 indicates identity STEFHPVHYDAHGR
2194 301.6864 601.3582 601.3548 5.81 0 4 0.77 +1Score > 21 indicates identity
Score > 16 indicates homology
IVAGSR
2804 432.2448 1293.7126 1293.7193 -5.22 0 4 0.64 +1Score > 15 indicates identity SHNIALIWNVK
3010 501.2828 1500.8266 1500.8049 14.5 1 4 1.3 +1Score > 18 indicates identity LSNITKVFHQGTR + Deamidated (NQ)
3092 528.6055 1582.7947 1582.7951 -0.26 0 4 1.2 +1Score > 18 indicates identity NIDLGQVTTTHINR + 2 Deamidated (NQ)
3400 688.6740 2063.0002 2063.0357 -17.2 0 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
SPMGALVYGSGGLLIDNGGLR + Deamidated (NQ); Oxidation (M)
2627 567.3001 1132.5856 1132.5910 -4.76 0 4 1.3 +1Score > 18 indicates identity LLMNDGLVSR + Oxidation (M)
4046 746.5969 2982.3585 2982.3903 -10.7 1 4 1.3 +1Score > 18 indicates identity QDEQKMVTQVISTVNDPYSDQVVIDK + 4 Deamidated (NQ)
2127 501.3178 500.3105 500.3071 6.88 0 4 1.8 +1Score > 19 indicates identity VIGGR
2228 642.3867 641.3794 641.3860 -10.3 1 4 0.7 +1Score > 15 indicates identity AGAKAPK
3085 791.3749 1580.7352 1580.7538 -11.7 1 4 1.1 +1Score > 17 indicates identity TAALVMNIDDMSKR + Deamidated (NQ); Oxidation (M)
3392 687.3524 2059.0354 2059.0408 -2.63 0 4 0.72 +1Score > 20 indicates identity
Score > 15 indicates homology
LEAMLPGYTAALATQPAEGR
3394 687.3546 2059.0420 2059.0408 0.58 0 4 0.52 +1Score > 20 indicates identity
Score > 14 indicates homology
LEAMLPGYTAALATQPAEGR
3507 735.0590 2202.1552 2202.1367 8.37 1 4 1.6 +1Score > 19 indicates identity KPWLQALNDAAFAMQRTNK
4316 617.9987 3701.9485 3701.8875 16.5 1 4 0.58 +1Score > 14 indicates identity LKPQNNLPELISGWRGELMAEALHNLLQEYPQ + Deamidated (NQ)
3884 910.1261 2727.3565 2727.3571 -0.24 1 4 1.7 +1Score > 19 indicates identity SNLLGPRDANGIPVPMTVDESIASMK + Oxidation (M)
2490 486.7931 971.5716 971.5651 6.73 1 4 0.71 +1Score > 15 indicates identity LEAGNVKLK + Deamidated (NQ)
4533 886.4363 5312.5741 5312.5281 8.67 1 4 1.2 +1Score > 17 indicates identity MVGQTIQWWLEYHDNQLTSLINNALQNAPDMQVAEQRIQLAEAQAK + 6 Deamidated (NQ)
2142 531.3276 530.3203 530.3176 5.09 1 4 1 +1Score > 23 indicates identity
Score > 16 indicates homology
QAGKK
4029 731.8333 2923.3041 2923.3341 -10.3 1 4 0.79 +1Score > 15 indicates identity AHVGDEEHRAMLEQQAWIGLMDQAR + Deamidated (NQ); 2 Oxidation (M)
2417 440.7383 879.4620 879.4702 -9.22 1 4 1.5 +1Score > 18 indicates identity FLSKQEK + Deamidated (NQ)
4176 1139.5736 3415.6990 3415.7003 -0.40 1 4 1.6 +1Score > 19 indicates identity DDAIRMGIQVGTPVTLYNPPQLLANDLVCSK + 2 Deamidated (NQ); Oxidation (M)
4452 739.1827 4429.0525 4429.1393 -19.6 1 4 1.4 +1Score > 18 indicates identity INIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTR + Oxidation (M)
2562 345.8503 1034.5291 1034.5331 -3.92 1 4 1.7 +1Score > 19 indicates identity QWKGLMTR + Oxidation (M)
2628 381.1891 1140.5455 1140.5233 19.4 0 4 1.2 +1Score > 17 indicates identity QALMGGFASSR + Deamidated (NQ); Oxidation (M)
4190 692.3627 3456.7771 3456.7203 16.4 0 4 1.4 +1Score > 18 indicates identity MGVKPGGNIALLACAGPMGIGAIDYAINGGIQPSR + 2 Deamidated (NQ); Oxidation (M)
2436 452.2126 902.4106 902.4280 -19.2 1 4 0.89 +1Score > 16 indicates identity MPKEQDR
3197 562.2930 1683.8572 1683.8428 8.56 0 4 1.7 +1Score > 19 indicates identity LTGVGAGASPNNLLDQR + 2 Deamidated (NQ)
3582 768.3782 2302.1128 2302.1038 3.88 1 4 2.1 +1Score > 20 indicates identity SSILDATIFLADKNDFAAMNK + 2 Deamidated (NQ); Oxidation (M)
4262 904.4343 3613.7081 3613.7129 -1.34 1 4 1.6 +1Score > 18 indicates identity ATVPVITHWDHGRSMEIIHNAWTHGMNSLMR + Deamidated (NQ); Oxidation (M)
2663 587.2916 1172.5686 1172.5673 1.14 0 4 1.1 +1Score > 16 indicates identity VLNNGDLGENK + Deamidated (NQ)
2759 623.3338 1244.6530 1244.6435 7.70 0 4 2.2 +1Score > 19 indicates identity VSELPVLMGER + Oxidation (M)
3946 697.8915 2787.5369 2787.5615 -8.84 1 4 0.48 +1Score > 13 indicates identity TRPLLVVLPKQMEQVTAILAVCHR + Oxidation (M)
4456 739.3475 4430.0413 4430.1233 -18.5 1 4 1.3 +1Score > 17 indicates identity INIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTR + Deamidated (NQ); Oxidation (M)
3215 855.9034 1709.7922 1709.7773 8.75 0 4 1.7 +1Score > 18 indicates identity GWIYQFHYHGMVR + Deamidated (NQ); Oxidation (M)
2315 373.7107 745.4068 745.4156 -11.8 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
VLEVMR
4041 990.1326 2967.3760 2967.4286 -17.7 1 3 1.8 +1Score > 19 indicates identity GLVAMNMMEGTLVQIRANAVVMATGGAGR + 2 Deamidated (NQ); 3 Oxidation (M)
2840 443.5288 1327.5646 1327.5649 -0.26 0 3 0.57 +1Score > 13 indicates identity CINTEGGYVCR
2845 444.8856 1331.6350 1331.6187 12.3 1 3 2.1 +1Score > 19 indicates identity QMSHMARNSVR + Oxidation (M)
2414 875.4128 874.4055 874.4144 -10.2 1 3 1.1 +1Score > 16 indicates identity NENRDVK + Deamidated (NQ)
2613 554.2574 1106.5002 1106.5138 -12.3 1 3 1.3 +1Score > 17 indicates identity MNEDASRIR + Oxidation (M)
2508 493.7412 985.4678 985.4716 -3.81 0 3 0.82 +1Score > 15 indicates identity AENGEEPIK
3442 704.6567 2110.9483 2110.9331 7.20 0 3 1.3 +1Score > 17 indicates identity WSINDFNAITEDQVNSQK + 3 Deamidated (NQ)
2449 464.7669 927.5192 927.5137 5.93 1 3 0.91 +1Score > 15 indicates identity ETNPRLAK
3901 912.4638 2734.3696 2734.3715 -0.69 1 3 2.2 +1Score > 19 indicates identity GQNFPVLYNQLPDRNAIVFATNDK + Deamidated (NQ)
3269 890.4293 1778.8440 1778.8291 8.40 0 3 2.1 +1Score > 19 indicates identity SLCQSMIDNQQLVSR + Deamidated (NQ)
3527 559.8018 2235.1781 2235.1786 -0.25 1 3 2 +1Score > 19 indicates identity SFEPLENALAHVKNIIATPAV + 2 Deamidated (NQ)
4257 721.1830 3600.8786 3600.8254 14.8 1 3 1 +1Score > 16 indicates identity EQAVLMTYYRNNIAHMLVLPSLMAAIVTQHR + 2 Deamidated (NQ); Oxidation (M)
2604 365.5296 1093.5670 1093.5767 -8.93 0 3 1.9 +1Score > 18 indicates identity ILYASETAAR
3785 643.5682 2570.2437 2570.2145 11.4 1 3 2.5 +1Score > 20 indicates identity NAGLTSAEVSAVIKAMQWQMDFR + 2 Deamidated (NQ); Oxidation (M)
4201 874.4230 3493.6629 3493.6163 13.3 1 3 2.1 +1Score > 19 indicates identity LIAPGADGVKMQCDLLSCQNAGWQGVTLNTTR + 4 Deamidated (NQ); Oxidation (M)
3538 750.4429 2248.3069 2248.2652 18.6 1 3 0.51 +1Score > 13 indicates identity LTGNTLEVAQLHSTLGRIIGR
2347 394.2151 786.4156 786.4058 12.5 0 3 2.4 +1Score > 19 indicates identity MGVHSLK + Oxidation (M)
3601 581.0013 2319.9761 2319.9987 -9.75 0 3 0.52 +1Score > 13 indicates identity MQQQLGDQYSELAANEGYMK + Deamidated (NQ); Oxidation (M)
3949 698.3453 2789.3521 2789.3847 -11.7 1 3 2.2 +1Score > 19 indicates identity GLQLIGWRDMQHALDYLFADGQLK + 2 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7  41 Next 

Not what you expected? Try the select summary.