MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1258_JBEI_Tube1_A1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:29 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,568

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 4077)


Page: 1 2 3 4 5 6  41 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2146 545.3314 544.3241 544.3221 3.81 0 22 0.091 +1Score > 24 indicates identity AVEVK
2141 531.3167 530.3094 530.3064 5.74 0 20 0.1 +1Score > 23 indicates identity IAEAK
2269 351.2200 700.4254 700.4232 3.27 1 19 0.074 +1Score > 20 indicates identity LGDKLR
3308 625.9724 1874.8954 1874.9295 -18.2 0 18 0.067 +1Score > 19 indicates identity QDILLLDGAMATELEAR + Deamidated (NQ); Oxidation (M)
3083 522.9312 1565.7718 1565.7838 -7.69 0 18 0.061 +1Score > 19 indicates identity TDPTSAFGGIIAFNR
2737 614.8373 1227.6600 1227.6571 2.40 1 18 0.081 +1Score > 19 indicates identity QRLDAINQLR + 2 Deamidated (NQ)
2626 377.8791 1130.6155 1130.6230 -6.65 1 17 0.076 +1Score > 18 indicates identity MRQALELVR + Oxidation (M)
2815 435.2218 1302.6436 1302.6238 15.2 0 16 0.12 +1Score > 19 indicates identity DSTMIIISHDR + Oxidation (M)
2409 437.2260 872.4374 872.4352 2.62 0 16 0.09 +1Score > 18 indicates identity QAQQELR + Deamidated (NQ)
2736 614.8369 1227.6592 1227.6571 1.75 1 15 0.13 +1Score > 19 indicates identity QRLDAINQLR + 2 Deamidated (NQ)
2399 428.7678 855.5210 855.5178 3.81 0 15 0.062 +1Score > 16 indicates identity LASVLTPR
3788 859.7708 2576.2906 2576.2394 19.9 1 15 0.16 +1Score > 19 indicates identity QANDLDYASLPDSVVEQVRAAWK + 2 Deamidated (NQ)
2634 382.8607 1145.5603 1145.5499 9.07 0 14 0.15 +1Score > 19 indicates identity LNGITMPNNR + Deamidated (NQ); Oxidation (M)
2707 602.7953 1203.5760 1203.5884 -10.2 1 13 0.18 +1Score > 18 indicates identity GNFQPDEKLR + Deamidated (NQ)
3050 767.3791 1532.7436 1532.7219 14.2 1 13 0.21 +1Score > 19 indicates identity RDPNQTEFAQAVR + 2 Deamidated (NQ)
2311 373.1972 744.3798 744.3919 -16.1 0 13 0.15 +1Score > 17 indicates identity WGIVNR + Deamidated (NQ)
2662 391.5435 1171.6087 1171.5873 18.2 1 13 0.18 +1Score > 18 indicates identity DYSKYLNIR + Deamidated (NQ)
2740 614.8394 1227.6642 1227.6571 5.82 1 13 0.22 +1Score > 19 indicates identity QRLDAINQLR + 2 Deamidated (NQ)
2140 531.2899 530.2826 530.2813 2.59 0 13 0.51 +1Score > 22 indicates identity AGIDR
2601 544.7792 1087.5438 1087.5258 16.6 1 13 0.23 +1Score > 19 indicates identity GNNRQIDIR + 3 Deamidated (NQ)
3126 405.9560 1619.7949 1619.7831 7.28 1 13 0.23 +1Score > 19 indicates identity SFKLYLNSFNQTR + 3 Deamidated (NQ)
2727 406.8715 1217.5927 1217.6148 -18.2 0 13 0.27 +1Score > 19 indicates identity SMGCGLLSLAPL
2584 533.7459 1065.4772 1065.4727 4.29 0 12 0.12 +1Score > 16 indicates identity YQSASPEQR + Deamidated (NQ)
2270 701.4331 700.4258 700.4232 3.81 1 12 0.35 +1Score > 20 indicates identity LGDKLR
2038 460.2791 459.2718 459.2805 -18.9 1 12 0.65 +1Score > 23 indicates identity KAGGK
2749 619.3644 1236.7142 1236.7302 -12.9 1 12 0.066 +1Score > 13 indicates identity TISAAARHAVIK
2312 745.3874 744.3801 744.3766 4.75 0 12 0.21 +1Score > 17 indicates identity NEINVR + Deamidated (NQ)
2325 772.4678 771.4605 771.4603 0.33 1 12 0.35 +1Score > 20 indicates identity KQIQVR + Deamidated (NQ)
2695 599.3423 1196.6700 1196.6666 2.89 1 11 0.14 +1Score > 15 indicates identity DVIPFPRTPR
2132 515.3320 514.3247 514.3227 3.89 0 11 0.65 +1Score > 22 indicates identity GAIVR
2549 512.7387 1023.4628 1023.4733 -10.3 1 11 0.16 +1Score > 16 indicates identity QTRNYDAR + Deamidated (NQ)
2135 518.2727 517.2654 517.2608 8.84 0 11 0.48 +1Score > 20 indicates identity NGATR
3004 500.9357 1499.7853 1499.8096 -16.3 1 11 0.34 +1Score > 19 indicates identity FDRQVVVGLPDVR + Deamidated (NQ)
2559 516.3011 1030.5876 1030.5771 10.2 1 11 0.21 +1Score > 16 indicates identity ETSRGGLAIK
2738 614.8373 1227.6600 1227.6823 -18.1 0 11 0.4 +1Score > 19 indicates identity QSLNSLLSPLR + Deamidated (NQ)
2388 421.7237 841.4328 841.4294 4.14 0 10 0.12 +1Score > 14 indicates identity VENPDLR
2130 503.2975 502.2902 502.2863 7.72 0 10 0.3 +1Score > 22 indicates identity
Score > 18 indicates homology
LGGTR
2649 386.5656 1156.6750 1156.6928 -15.4 1 10 0.26 +1Score > 16 indicates identity ILTEGRTVIR
2534 505.2618 1008.5090 1008.5280 -18.8 0 10 0.43 +1Score > 19 indicates identity EFFGLTKPA
3177 558.6513 1672.9321 1672.9004 18.9 1 10 0.21 +1Score > 15 indicates identity NAMLDIGLAMPVKIR + 2 Oxidation (M)
2635 382.8609 1145.5609 1145.5499 9.59 0 10 0.44 +1Score > 19 indicates identity LNGITMPNNR + Deamidated (NQ); Oxidation (M)
2861 674.3275 1346.6404 1346.6619 -15.9 0 10 0.35 -1Score > 18 indicates identity QFSPHSFQQLK + Deamidated (NQ)
2475 479.7737 957.5328 957.5495 -17.4 0 10 0.42 +1Score > 18 indicates identity VKPSSAELK
2636 574.7689 1147.5232 1147.5430 -17.3 1 10 0.28 +1Score > 16 indicates identity LPQEEKMEK + Deamidated (NQ); Oxidation (M)
3741 833.7842 2498.3308 2498.3454 -5.87 0 10 0.22 +1Score > 16 indicates identity TVTSQVLIFEIMPAPPAIASQLR + Deamidated (NQ); Oxidation (M)
2455 471.7907 941.5668 941.5480 20.0 0 9 0.21 +1Score > 15 indicates identity LQLKPGMR
2290 730.4267 729.4194 729.4133 8.38 1 9 0.46 +1Score > 18 indicates identity QKLGER
2587 535.8098 1069.6050 1069.5954 9.04 1 9 0.28 +1Score > 16 indicates identity HIKMAIVDK + Oxidation (M)
3560 762.7216 2285.1430 2285.1077 15.5 1 9 0.54 +1Score > 19 indicates identity LRFLTSSNPDHPTGNIFDPR + 2 Deamidated (NQ)
3229 431.2230 1720.8629 1720.8757 -7.47 1 9 0.58 +1Score > 19 indicates identity DVDFASLRHQHIGAR
2827 438.8654 1313.5744 1313.5809 -4.97 0 9 0.16 +1Score > 14 indicates identity TEFNALMESEK + Oxidation (M)
3984 949.5257 2845.5553 2845.5436 4.09 1 9 0.12 +1Score > 13 indicates identity AIQQQIENPLAQQILSGELVPGKVIR + 4 Deamidated (NQ)
2685 396.8646 1187.5720 1187.5895 -14.7 1 9 0.4 +1Score > 17 indicates identity RGVVDETEAGR
2533 505.2611 1008.5076 1008.5240 -16.2 0 9 0.58 +1Score > 19 indicates identity YLSLAETGR
2387 420.6945 839.3744 839.3748 -0.48 0 9 0.16 +1Score > 13 indicates identity TWFCAR
3020 503.9364 1508.7874 1508.7875 -0.058 0 9 0.49 +1Score > 18 indicates identity QPVYQLYTLLNR + 2 Deamidated (NQ)
2739 614.8386 1227.6626 1227.6571 4.52 1 9 0.58 +1Score > 19 indicates identity QRLDAINQLR + 2 Deamidated (NQ)
3332 634.0170 1899.0292 1899.0200 4.81 0 8 0.35 +1Score > 16 indicates identity LAVGEALTNIAATQIGDIK + 2 Deamidated (NQ)
2910 469.2509 1404.7309 1404.7469 -11.4 1 8 0.62 +1Score > 19 indicates identity KLVGANIAMDMVK + Oxidation (M)
2129 503.2940 502.2867 502.2863 0.78 0 8 0.69 +1Score > 22 indicates identity
Score > 19 indicates homology
ISGAR
2126 501.3162 500.3089 500.3071 3.74 0 8 0.73 +1Score > 19 indicates identity ALAAR
2310 745.3870 744.3797 744.3766 4.17 0 8 0.46 +1Score > 17 indicates identity QDVDLR
3239 435.7309 1738.8945 1738.8889 3.19 1 8 0.55 +1Score > 18 indicates identity KIFNNLDNLSYIQR + 2 Deamidated (NQ)
2631 571.8603 1141.7060 1141.7070 -0.86 1 8 0.16 +1Score > 13 indicates identity KQTALVELLK
2225 634.3357 633.3284 633.3268 2.54 0 8 0.48 +1Score > 17 indicates identity ALMQR + Oxidation (M)
2556 344.5185 1030.5337 1030.5407 -6.83 1 8 0.93 +1Score > 20 indicates identity GKAVSDVAER
2324 771.4027 770.3954 770.3922 4.13 0 8 0.22 +1Score > 14 indicates identity GAEQPLR + Deamidated (NQ)
2042 461.2723 460.2650 460.2645 1.05 0 8 0.73 +1Score > 20 indicates identity
Score > 19 indicates homology
SAVGK
3141 548.2820 1641.8242 1641.8508 -16.2 1 8 0.59 +1Score > 18 indicates identity MTKHTLEQLAADLR + Oxidation (M)
2918 473.9252 1418.7538 1418.7518 1.42 0 8 0.79 +1Score > 19 indicates identity HLSQEIPATPGIR + Deamidated (NQ)
3715 822.1017 2463.2833 2463.2427 16.5 1 8 0.6 +1Score > 18 indicates identity LQPGIYKNMGSNSVNIIINNTR + 2 Deamidated (NQ); Oxidation (M)
2596 1081.5024 1080.4951 1080.4948 0.29 1 8 0.54 +1Score > 17 indicates identity SDERYQQR
2232 647.3433 646.3360 646.3286 11.5 0 8 0.84 +1Score > 19 indicates identity ELETR
2251 672.4062 671.3989 671.3966 3.45 0 8 0.83 +1Score > 20 indicates identity
Score > 19 indicates homology
GNVLIR + Deamidated (NQ)
1933 429.2120 428.2047 428.2020 6.48 0 7 0.18 +1Score > 13 indicates identity APGGQ
3621 586.0231 2340.0633 2340.0943 -13.3 0 7 0.54 +1Score > 17 indicates identity YLNNINGLLTSFCGADAPQLR + 4 Deamidated (NQ)
2219 312.1618 622.3090 622.3074 2.57 0 7 0.64 +1Score > 18 indicates identity YGNIR + Deamidated (NQ)
3195 842.9329 1683.8512 1683.8502 0.64 0 7 0.81 +1Score > 19 indicates identity ALTSSGFDAIMVISTR + Oxidation (M)
2679 592.3439 1182.6732 1182.6833 -8.49 1 7 0.3 +1Score > 14 indicates identity LQVVDRNLAR
2563 518.2724 1034.5302 1034.5331 -2.78 1 7 0.91 +1Score > 19 indicates identity QWKGLMTR + Oxidation (M)
2227 642.3862 641.3789 641.3860 -11.1 1 7 0.37 +1Score > 15 indicates identity AGAKAPK
2131 514.2638 513.2565 513.2659 -18.4 0 7 0.23 +1Score > 13 indicates identity GPGAGR
2435 903.4179 902.4106 902.4093 1.43 0 7 0.43 +1Score > 16 indicates identity QNLENQR + 2 Deamidated (NQ)
3017 503.2720 1506.7942 1506.8194 -16.8 0 7 0.79 +1Score > 18 indicates identity QPVYQLYTLLNR
2837 442.2200 1323.6382 1323.6129 19.1 0 7 0.68 +1Score > 18 indicates identity MLSAFQLENNR + 2 Deamidated (NQ)
3036 508.5998 1522.7776 1522.7701 4.92 0 7 0.83 +1Score > 18 indicates identity ELIEMLYVNINR + Deamidated (NQ); Oxidation (M)
3242 871.4776 1740.9406 1740.9192 12.3 1 7 0.52 +1Score > 16 indicates identity QVRGDILNSMLPIER + Deamidated (NQ)
4453 739.1828 4429.0531 4429.1393 -19.5 1 7 0.71 +1Score > 18 indicates identity INIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTR + Oxidation (M)
2293 367.2043 732.3940 732.3952 -1.62 0 7 1 +1Score > 19 indicates identity MGLALGR + Oxidation (M)
2362 400.2019 798.3892 798.3806 10.8 0 7 0.27 +1Score > 13 indicates identity DGMHAIR
3068 773.3802 1544.7458 1544.7617 -10.2 1 7 1 +1Score > 19 indicates identity LLNESPDAQVRMR + Deamidated (NQ); Oxidation (M)
3194 561.9863 1682.9371 1682.9216 9.18 1 6 0.39 +1Score > 15 indicates identity LAVHDVLTNIYNRR
2229 322.7085 643.4024 643.4017 1.18 1 6 0.57 +1Score > 21 indicates identity
Score > 17 indicates homology
IQKVR + Deamidated (NQ)
2691 399.2106 1194.6100 1194.5880 18.4 1 6 0.77 +1Score > 18 indicates identity NKGAYSLADEK
2839 664.7889 1327.5632 1327.5822 -14.3 1 6 0.27 +1Score > 13 indicates identity VKECEEMMIK + 2 Oxidation (M)
2597 541.3171 1080.6196 1080.6001 18.1 1 6 0.23 +1Score > 13 indicates identity MKLNATYIK
3204 566.6197 1696.8373 1696.8243 7.65 0 6 1.1 +1Score > 19 indicates identity LIQDFDGIFNQTMR
2337 779.4307 778.4234 778.4337 -13.2 1 6 0.81 +1Score > 18 indicates identity KHGNIPL + Deamidated (NQ)
3027 506.5896 1516.7470 1516.7490 -1.32 1 6 1.1 +1Score > 19 indicates identity SHIMAAKAVANTMR + Deamidated (NQ); Oxidation (M)
2411 437.2418 872.4690 872.4716 -2.88 0 6 1.1 +1Score > 19 indicates identity TLINEQR
Page: 1 2 3 4 5 6  41 Next 

Not what you expected? Try the select summary.