MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1258_JBEI_Tube1_A1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:29 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,568

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 11–20 (out of 45)


Page: Previous 1 2 3 4 5 Next 

+11

Accession Score Description
1 PEPB_ECOLI 69 Peptidase B OS=Escherichia coli (strain K12) GN=pepB PE=3 SV=2

+12

Accession Score Description
1 POXB_ECOLI 65 Pyruvate dehydrogenase [ubiquinone] OS=Escherichia coli (strain K12) GN=poxB PE=1 SV=1

+13

Accession Score Description
1 SDHA_ECOLI 61 Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli (strain K12) GN=sdhA PE=1 SV=1

+14

Accession Score Description
1 IPYR_ECOLI 51 Inorganic pyrophosphatase OS=Escherichia coli (strain K12) GN=ppa PE=1 SV=2

-15

Accession Score Description
1 RPOB_ECOLI 50 DNA-directed RNA polymerase subunit beta OS=Escherichia coli (strain K12) GN=rpoB PE=1 SV=1
Score Mass Matches Sequences emPAI
15.1 RPOB_ECOLI 50 150937 4 (1) 4 (1) 0.02
DNA-directed RNA polymerase subunit beta OS=Escherichia coli (strain K12) GN=rpoB PE=1 SV=1

-4 peptide matches (4 non-duplicate, 0 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
2548   342.1569 1023.4489 1023.4477 1.12 0 0 1.3 +2Score > 14 indicates identity R.ALMGANMQR.Q + Deamidated (NQ); 2 Oxidation (M)
3013   502.2611 1503.7615 1503.7490 8.30 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
U K.INAMLKQQQEVAK.L + 4 Deamidated (NQ)
3986   951.1371 2850.3895 2850.3496 14.0 0 50 5.3e-005 +1Score > 19 indicates identity U R.FGEMEVWALEAYGAAYTLQEMLTVK.S + Deamidated (NQ)
4458   1114.7632 4455.0237 4455.0305 -1.52 1 0 1.2 +1Score > 13 indicates identity U R.DQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQR.Q + 3 Deamidated (NQ); 2 Oxidation (M)

+16

Accession Score Description
1 K2C1_HUMAN 49 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6

+17

Accession Score Description
1 ATPB_ECOLI 49 ATP synthase subunit beta OS=Escherichia coli (strain K12) GN=atpD PE=1 SV=2

+18

Accession Score Description
1 ADHP_ECOLI 47 Alcohol dehydrogenase, propanol-preferring OS=Escherichia coli (strain K12) GN=adhP PE=1 SV=1

+19

Accession Score Description
1 LPP_ECOLI 43 Major outer membrane lipoprotein Lpp OS=Escherichia coli (strain K12) GN=lpp PE=1 SV=1

+20

Accession Score Description
1 Q835L3_ENTFA 42 Acetyl-CoA acetyltransferase/hydroxymethylglutaryl-CoA reductase, degradative OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=EF_1364 PE=3 SV=1
Page: Previous 1 2 3 4 5 Next 

Not what you expected? Try the select summary.