MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1258_JBEI_Tube1_A1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:29 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,568

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 45)


Page: 1 2 3 4 5 Next 

-1

Accession Score Description
1 DNAK_ECOLI 7858 Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2
Score Mass Matches Sequences emPAI
1.1 DNAK_ECOLI 7858 69130 293 (254) 65 (60) 206.58
Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2

-293 peptide matches (135 non-duplicate, 158 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
2192   602.3542 601.3469 601.3435 5.71 0 24 0.033 +1Score > 22 indicates identity U K.AAIEAK.M
2193 +1 301.6809 601.3472 601.3435 6.25 0 30 0.0074 +1Score > 22 indicates identity U K.AAIEAK.M
2211 +2 307.7092 613.4038 613.4024 2.43 1 19 0.017 +1Score > 14 indicates identity U K.RLIGR.R
2212 +1 307.7096 613.4046 613.4024 3.73 1 15 0.053 +1Score > 15 indicates identity U R.LIGRR.F
2256 +2 343.7080 685.4014 685.4010 0.63 0 33 0.0015 +1Score > 18 indicates identity U R.SIEPLK.V
2258 +1 686.4108 685.4035 685.4010 3.66 0 29 0.0038 +1Score > 18 indicates identity U R.SIEPLK.V
2285 +2 365.2296 728.4446 728.4432 1.96 0 44 0.00013 +1Score > 18 indicates identity U R.IAGLEVK.R
2288 +1 729.4539 728.4466 728.4432 4.67 0 36 0.00084 +1Score > 18 indicates identity U R.IAGLEVK.R
2329 +1 774.4365 773.4292 773.4283 1.18 0 29 0.0056 +1Score > 19 indicates identity U K.NTTIPTK.H
2331 +3 387.7220 773.4294 773.4283 1.47 0 49 6.3e-005 +1Score > 19 indicates identity U K.NTTIPTK.H
2336   388.2122 774.4098 774.4123 -3.20 0 63 2.4e-006 +1Score > 20 indicates identity U K.NTTIPTK.H + Deamidated (NQ)
2350   394.7307 787.4468 787.4439 3.71 1 12 0.28 +1Score > 19 indicates identity U R.LKEAAEK.A
2359 +1 797.4241 796.4168 796.4119 6.13 0 43 0.00011 +1Score > 16 indicates identity U K.VAEFFGK.E
2360 +2 399.2162 796.4178 796.4119 7.42 0 43 9.2e-005 +1Score > 15 indicates identity U K.VAEFFGK.E
2371   816.4243 815.4170 815.4137 4.04 0 45 0.00012 +1Score > 19 indicates identity U K.DQGIDLR.N
2374 +2 408.7177 815.4208 815.4137 8.73 0 41 0.0003 +1Score > 19 indicates identity U K.DQGIDLR.N
2420 +2 443.2808 884.5470 884.5443 3.08 1 47 4.2e-005 +1Score > 15 indicates identity U R.IAGLEVKR.I
2443   309.1771 924.5095 924.5069 2.79 1 22 0.0077 +1Score > 13 indicates identity U K.KVAEFFGK.E
2444 +1 463.2621 924.5096 924.5069 2.98 1 47 2.4e-005 +1Score > 13 indicates identity U K.KVAEFFGK.E
2462   472.7639 943.5132 943.5087 4.84 1 46 0.00012 +1Score > 20 indicates identity U K.KDQGIDLR.N
2463   315.5117 943.5133 943.5087 4.86 1 27 0.012 +1Score > 20 indicates identity U K.KDQGIDLR.N
2468 +3 476.7445 951.4744 951.4736 0.94 0 24 0.01 +1Score > 16 indicates identity U R.DVSIMPFK.I + Oxidation (M)
2471 +1 952.4854 951.4781 951.4736 4.80 0 40 0.00021 +1Score > 16 indicates identity U R.DVSIMPFK.I + Oxidation (M)
2477   960.4588 959.4515 959.4494 2.16 0 14 0.13 +1Score > 17 indicates identity U R.NDPLAMQR.L + Oxidation (M)
2479 +2 480.7339 959.4532 959.4494 3.96 0 34 0.0015 +1Score > 18 indicates identity U R.NDPLAMQR.L + Oxidation (M)
2522 +2 501.7472 1001.4798 1001.4778 2.08 0 54 1.2e-005 +1Score > 17 indicates identity U R.VLENAEGDR.T
2525   1002.4898 1001.4825 1001.4778 4.75 0 23 0.013 +1Score > 17 indicates identity U R.VLENAEGDR.T
2538   338.8557 1013.5453 1013.5440 1.23 1 9 0.42 +1Score > 18 indicates identity U K.HMNIKVTR.A + Oxidation (M)
2547 +1 511.2725 1020.5304 1020.5240 6.32 0 43 0.00021 +1Score > 19 indicates identity U K.FEELVQTR.N
2555   344.5184 1030.5334 1030.5294 3.81 1 33 0.0029 +1Score > 20 indicates identity U K.GEDKAAIEAK.M
2558 +1 516.2746 1030.5346 1030.5294 5.04 1 33 0.0024 +1Score > 20 indicates identity
Score > 19 indicates homology
U K.GEDKAAIEAK.M
2570   1050.4869 1049.4796 1049.4778 1.75 0 30 0.0023 +1Score > 16 indicates identity U R.FQDEEVQR.D
2571 +2 525.7477 1049.4808 1049.4778 2.92 0 56 5.7e-006 +1Score > 16 indicates identity U R.FQDEEVQR.D
2579 +1 531.2308 1060.4470 1060.4421 4.67 0 39 0.00013 +1Score > 13 indicates identity U R.DAEANAEADR.K
2638 +2 575.3183 1148.6220 1148.6190 2.69 1 76 7.5e-008 +1Score > 18 indicates identity U R.KFEELVQTR.N
2639 +2 383.8816 1148.6230 1148.6190 3.49 1 47 7.2e-005 +1Score > 18 indicates identity U R.KFEELVQTR.N
2653   581.3018 1160.5890 1160.5859 2.68 0 64 2.1e-006 +1Score > 20 indicates identity U K.MQELAQVSQK.L
2654   581.7962 1161.5778 1161.5699 6.80 0 31 0.0035 +1Score > 19 indicates identity U K.MQELAQVSQK.L + Deamidated (NQ)
2665   1177.5898 1176.5825 1176.5809 1.42 0 44 0.00017 +1Score > 19 indicates identity U K.MQELAQVSQK.L + Oxidation (M)
2666 +2 589.2991 1176.5836 1176.5809 2.37 0 58 6.8e-006 +1Score > 19 indicates identity U K.MQELAQVSQK.L + Oxidation (M)
2669   393.2025 1176.5857 1176.5809 4.09 0 35 0.0016 +1Score > 19 indicates identity U K.MQELAQVSQK.L + Oxidation (M)
2674 +3 393.8789 1178.6149 1178.6084 5.49 1 47 7.8e-005 +1Score > 18 indicates identity U K.VAEFFGKEPR.K
2675 +1 590.3151 1178.6156 1178.6084 6.15 1 66 9.6e-007 +1Score > 18 indicates identity U K.VAEFFGKEPR.K
2712 +1 603.7976 1205.5806 1205.5789 1.46 1 48 9.2e-005 +1Score > 20 indicates identity U R.RFQDEEVQR.D
2714 +1 402.8676 1205.5810 1205.5789 1.73 1 47 0.00011 +1Score > 20 indicates identity U R.RFQDEEVQR.D
2772 +1 634.3525 1266.6904 1266.6860 3.54 0 57 3.1e-006 +1Score > 15 indicates identity U R.LINYLVEEFK.K
2777 +3 320.1642 1276.6277 1276.6272 0.35 0 29 0.006 +1Score > 19 indicates identity U R.NQGDHLLHSTR.K
2779 +3 426.5504 1276.6294 1276.6272 1.67 0 45 0.00015 +1Score > 19 indicates identity U R.NQGDHLLHSTR.K
2782 +1 639.3230 1276.6314 1276.6272 3.29 0 67 9.2e-007 +1Score > 20 indicates identity U R.NQGDHLLHSTR.K
2793 +2 643.8510 1285.6874 1285.6878 -0.24 0 68 7.2e-007 +1Score > 20 indicates identity U K.LESLVEDLVNR.S
2794 +1 429.5709 1285.6909 1285.6878 2.42 0 49 6.9e-005 +1Score > 19 indicates identity U K.LESLVEDLVNR.S
2799 +2 645.8113 1289.6080 1289.6099 -1.43 0 97 7.2e-010 +1Score > 18 indicates identity U K.ASSGLNEDEIQK.M
2802   430.8792 1289.6158 1289.6099 4.56 0 30 0.0037 +1Score > 19 indicates identity U K.ASSGLNEDEIQK.M
2809   433.9051 1298.6935 1298.6904 2.37 0 30 0.0034 +1Score > 18 indicates identity U K.MAPPQISAEVLK.K + Oxidation (M)
2810 +1 650.3550 1298.6954 1298.6904 3.89 0 60 3.6e-006 +1Score > 18 indicates identity U K.MAPPQISAEVLK.K + Oxidation (M)
2879 +3 698.3987 1394.7828 1394.7809 1.39 1 56 3.5e-006 +1Score > 14 indicates identity U R.LINYLVEEFKK.D
2881 +15 465.9360 1394.7862 1394.7809 3.77 1 48 2.1e-005 +1Score > 14 indicates identity U R.LINYLVEEFKK.D
2899   466.2639 1395.7699 1395.7649 3.55 1 31 0.0018 +1Score > 16 indicates identity U R.LINYLVEEFKK.D + Deamidated (NQ)
2905 +1 352.1886 1404.7253 1404.7222 2.21 1 13 0.24 +1Score > 19 indicates identity U R.NQGDHLLHSTRK.Q
2908 +2 469.2503 1404.7291 1404.7222 4.89 1 21 0.031 +1Score > 19 indicates identity U R.NQGDHLLHSTRK.Q
2923 +1 476.6046 1426.7920 1426.7854 4.64 1 56 5e-006 +1Score > 16 indicates identity U K.MAPPQISAEVLKK.M + Oxidation (M)
2926 +1 714.4064 1426.7982 1426.7854 9.04 1 41 0.00012 +1Score > 15 indicates identity U K.MAPPQISAEVLKK.M + Oxidation (M)
2980 +4 743.4208 1484.8270 1484.8198 4.87 1 78 4.1e-008 +1Score > 17 indicates identity U R.AKLESLVEDLVNR.S
2987 +13 495.9514 1484.8324 1484.8198 8.45 1 71 1.8e-007 +1Score > 16 indicates identity U R.AKLESLVEDLVNR.S
3003   750.8943 1499.7740 1499.7620 8.04 0 90 4.8e-009 +1Score > 19 indicates identity U K.IIAADNGDAWVEVK.G
3006 +2 751.3888 1500.7630 1500.7460 11.4 0 98 7.4e-010 +1Score > 19 indicates identity U K.IIAADNGDAWVEVK.G + Deamidated (NQ)
3008   501.2635 1500.7687 1500.7460 15.1 0 27 0.0083 +1Score > 19 indicates identity U K.IIAADNGDAWVEVK.G + Deamidated (NQ)
3019   755.3345 1508.6544 1508.6519 1.72 0 36 0.0003 +1Score > 13 indicates identity U K.DDDVVDAEFEEVK.D
3022   505.5847 1513.7323 1513.7260 4.14 1 25 0.0086 +1Score > 17 indicates identity U K.QVEEAGDKLPADDK.T
3066 +1 515.6224 1543.8454 1543.8358 6.18 0 46 7.8e-005 +1Score > 18 indicates identity U R.QAVTNPQNTLFAIK.R
3067 +1 772.9306 1543.8466 1543.8358 7.01 0 90 3.4e-009 +1Score > 18 indicates identity U R.QAVTNPQNTLFAIK.R
3069   773.4240 1544.8334 1544.8198 8.81 0 39 0.00051 +1Score > 18 indicates identity U R.QAVTNPQNTLFAIK.R + Deamidated (NQ)
3102 +2 533.6146 1597.8220 1597.8212 0.46 0 66 1e-006 +1Score > 19 indicates identity U K.SLGQFNLDGINPAPR.G
3103 +3 799.9203 1597.8260 1597.8212 3.01 0 97 7.7e-010 +1Score > 19 indicates identity U K.SLGQFNLDGINPAPR.G
3108   533.9501 1598.8285 1598.8053 14.5 0 51 3.1e-005 +1Score > 18 indicates identity U K.SLGQFNLDGINPAPR.G + Deamidated (NQ)
3150 +2 830.4521 1658.8896 1658.8879 1.06 0 92 2.5e-009 +1Score > 18 indicates identity U R.IINEPTAAALAYGLDK.G
3151 +1 553.9707 1658.8903 1658.8879 1.43 0 86 8.4e-009 +1Score > 18 indicates identity U R.IINEPTAAALAYGLDK.G
3155   830.9551 1659.8956 1659.8719 14.3 0 90 2.7e-009 +1Score > 17 indicates identity U R.IINEPTAAALAYGLDK.G + Deamidated (NQ)
3207   850.9789 1699.9432 1699.9369 3.71 1 102 1.8e-010 +1Score > 17 indicates identity U R.QAVTNPQNTLFAIKR.L
3208 +1 567.9818 1700.9236 1700.9209 1.55 1 72 2.2e-007 +1Score > 18 indicates identity U R.QAVTNPQNTLFAIKR.L + Deamidated (NQ)
3210   851.4803 1700.9460 1700.9209 14.8 1 1 1.6 +1Score > 16 indicates identity U K.RQAVTNPQNTLFAIK.R + Deamidated (NQ)
3212 +1 567.9905 1700.9497 1700.9209 16.9 1 55 6.7e-006 +1Score > 15 indicates identity U R.QAVTNPQNTLFAIKR.L + Deamidated (NQ)
3249   582.6512 1744.9318 1744.9207 6.37 1 15 0.11 +1Score > 18 indicates identity U K.ITIKASSGLNEDEIQK.M
3255   586.6271 1756.8595 1756.8526 3.90 1 15 0.12 +1Score > 19 indicates identity U K.DQGIDLRNDPLAMQR.L + Oxidation (M)
3257   586.9548 1757.8426 1757.8366 3.38 1 24 0.015 +1Score > 18 indicates identity U K.DQGIDLRNDPLAMQR.L + Deamidated (NQ); Oxidation (M)
3286   908.5037 1814.9928 1814.9890 2.12 1 55 7.4e-006 +1Score > 16 indicates identity U K.RIINEPTAAALAYGLDK.G
3288 +1 606.3423 1816.0051 1815.9730 17.7 1 35 0.00051 +1Score > 15 indicates identity U K.RIINEPTAAALAYGLDK.G + Deamidated (NQ)
3348   981.0320 1960.0494 1960.0364 6.65 1 83 1.4e-008 +1Score > 16 indicates identity U K.TAIESALTALETALKGEDK.A
3349 +1 654.3592 1960.0558 1960.0364 9.88 1 90 2.9e-009 +1Score > 17 indicates identity U K.TAIESALTALETALKGEDK.A
3357   661.9922 1982.9548 1982.9408 7.06 1 1 4 +1Score > 19 indicates identity U R.FQDEEVQRDVSIMPFK.I + Oxidation (M)
3435   700.3668 2098.0786 2098.0443 16.3 1 49 4.8e-005 +1Score > 19 indicates identity U R.AADNKSLGQFNLDGINPAPR.G + Deamidated (NQ)
3436   700.6928 2099.0566 2099.0283 13.5 1 54 1.7e-005 +1Score > 19 indicates identity U R.AADNKSLGQFNLDGINPAPR.G + 2 Deamidated (NQ)
3461 +1 716.0511 2145.1315 2145.1066 11.6 1 59 4.1e-006 +1Score > 18 indicates identity U R.IINEPTAAALAYGLDKGTGNR.T + Deamidated (NQ)
3492 +1 731.0490 2190.1252 2190.1056 8.94 0 74 1.3e-007 +1Score > 18 indicates identity U R.TTPSIIAYTQDGETLVGQPAK.R + Deamidated (NQ)
3493 +1 1096.0725 2190.1304 2190.1056 11.3 0 79 4.8e-008 +1Score > 18 indicates identity U R.TTPSIIAYTQDGETLVGQPAK.R + Deamidated (NQ)
3551   1141.0280 2280.0414 2280.0295 5.24 0 114 9.3e-012 +1Score > 16 indicates identity U K.TFEVLATNGDTHLGGEDFDSR.L
3552   761.3568 2281.0486 2281.0135 15.4 0 69 3.8e-007 +1Score > 18 indicates identity U K.TFEVLATNGDTHLGGEDFDSR.L + Deamidated (NQ)
3574   766.0709 2295.1909 2295.1594 13.7 0 30 0.005 +1Score > 20 indicates identity U K.DVNPDEAVAIGAAVQGGVLTGDVK.D + Deamidated (NQ)
3602 +1 1161.5833 2321.1520 2321.1243 11.9 0 100 6.2e-010 +1Score > 20 indicates identity U K.IIGIDLGTTNSCVAIMDGTTPR.V + Deamidated (NQ); Oxidation (M)
3604   774.7271 2321.1595 2321.1243 15.1 0 67 6.4e-007 +1Score > 20 indicates identity
Score > 17 indicates homology
U K.IIGIDLGTTNSCVAIMDGTTPR.V + Deamidated (NQ); Oxidation (M)
3628   587.3151 2345.2313 2345.2227 3.67 1 63 1.9e-006 +1Score > 18 indicates identity U R.TTPSIIAYTQDGETLVGQPAKR.Q
D:\Xcalibur\Data\Jennifer\PRT1258 ThomasE\PRT1258_JBEI_Tube1_A1.raw

Score > 18 indicates identity

3629   1174.1224 2346.2302 2346.2067 10.0 1 92 2.3e-009 -1Score > 18 indicates identity U R.TTPSIIAYTQDGETLVGQPAKR.Q + Deamidated (NQ)
10.0 1 86 8.2e-009 2 R.TTPSIIAYTQDGETLVGQPAKR.Q + Deamidated (NQ)
3630 +2 783.0842 2346.2308 2346.2067 10.3 1 78 6.3e-008 +1Score > 18 indicates identity U R.TTPSIIAYTQDGETLVGQPAKR.Q + Deamidated (NQ)
3681   808.4330 2422.2772 2422.2704 2.80 1 6 0.78 +1Score > 17 indicates identity U R.KDVNPDEAVAIGAAVQGGVLTGDVK.D
3685 +2 808.7653 2423.2741 2423.2544 8.12 1 67 5.5e-007 +1Score > 17 indicates identity U R.KDVNPDEAVAIGAAVQGGVLTGDVK.D + Deamidated (NQ)
3690 +3 808.7703 2423.2891 2423.2544 14.3 1 66 6.6e-007 +1Score > 16 indicates identity U R.KDVNPDEAVAIGAAVQGGVLTGDVK.D + Deamidated (NQ)
3698 +1 814.4431 2440.3075 2440.2810 10.9 0 22 0.011 +1Score > 15 indicates identity U K.VALQDAGLSVSDIDDVILVGGQTR.M
3700 +2 814.7712 2441.2918 2441.2650 11.0 0 91 2.2e-009 +1Score > 17 indicates identity U K.VALQDAGLSVSDIDDVILVGGQTR.M + Deamidated (NQ)
3706 +3 814.7770 2441.3092 2441.2650 18.1 0 29 0.0023 +1Score > 15 indicates identity U K.VALQDAGLSVSDIDDVILVGGQTR.M + Deamidated (NQ)
3762   845.1024 2532.2854 2532.2595 10.2 0 9 0.61 +1Score > 19 indicates identity U K.IELSSAQQTDVNLPYITADATGPK.H + Deamidated (NQ)
3764 +1 845.1051 2532.2935 2532.2595 13.4 0 79 5.7e-008 +1Score > 19 indicates identity U K.IELSSAQQTDVNLPYITADATGPK.H + Deamidated (NQ)
3816   881.0878 2640.2416 2640.2198 8.26 0 114 1.6e-011 +1Score > 18 indicates identity U K.LMEIAQQQHAQQQTAGADASANNAK.D + Deamidated (NQ); Oxidation (M)
3817   661.0692 2640.2477 2640.2198 10.6 0 43 0.00021 +1Score > 19 indicates identity U K.LMEIAQQQHAQQQTAGADASANNAK.D + Deamidated (NQ); Oxidation (M)
3827 +1 664.3326 2653.3013 2653.2732 10.6 0 95 1.5e-009 +1Score > 19 indicates identity U K.HSQVFSTAEDNQSAVTIHVLQGER.K + Deamidated (NQ)
3828 +3 885.4411 2653.3015 2653.2732 10.6 0 102 3.2e-010 +1Score > 19 indicates identity U K.HSQVFSTAEDNQSAVTIHVLQGER.K + Deamidated (NQ)
3829 +7 664.3330 2653.3029 2653.2732 11.2 0 73 2.7e-007 +1Score > 20 indicates identity U K.HSQVFSTAEDNQSAVTIHVLQGER.K + Deamidated (NQ)
3888 +9 911.4795 2731.4167 2731.3916 9.19 1 95 9.7e-010 +1Score > 17 indicates identity U K.AKIELSSAQQTDVNLPYITADATGPK.H + Deamidated (NQ)
3890 +2 911.4829 2731.4269 2731.3916 12.9 1 37 0.00046 +1Score > 16 indicates identity U K.AKIELSSAQQTDVNLPYITADATGPK.H + Deamidated (NQ)
3938   557.2870 2781.3986 2781.3682 10.9 1 21 0.03 +1Score > 18 indicates identity U K.HSQVFSTAEDNQSAVTIHVLQGERK.R + Deamidated (NQ)
3939   696.3574 2781.4005 2781.3682 11.6 1 58 6e-006 +1Score > 18 indicates identity U K.HSQVFSTAEDNQSAVTIHVLQGERK.R + Deamidated (NQ)
3995   718.3535 2869.3849 2869.3658 6.67 0 15 0.05 +1Score > 20 indicates identity
Score > 14 indicates homology
U K.TAEDYLGEPVTEAVITVPAYFNDAQR.Q + Deamidated (NQ)
3996 +1 957.4744 2869.4014 2869.3658 12.4 0 75 1.3e-007 +1Score > 20 indicates identity
Score > 18 indicates homology
U K.TAEDYLGEPVTEAVITVPAYFNDAQR.Q + Deamidated (NQ)
4002   957.8041 2870.3905 2870.3498 14.2 0 29 0.0059 +1Score > 20 indicates identity U K.TAEDYLGEPVTEAVITVPAYFNDAQR.Q + 2 Deamidated (NQ)
4051   1000.1740 2997.5002 2997.4607 13.2 1 27 0.009 +1Score > 19 indicates identity U K.KTAEDYLGEPVTEAVITVPAYFNDAQR.Q + Deamidated (NQ)
4052   750.3845 2997.5089 2997.4607 16.1 1 15 0.15 +1Score > 19 indicates identity U K.KTAEDYLGEPVTEAVITVPAYFNDAQR.Q + Deamidated (NQ)
4053   1000.5043 2998.4911 2998.4447 15.5 1 14 0.16 +1Score > 19 indicates identity U K.KTAEDYLGEPVTEAVITVPAYFNDAQR.Q + 2 Deamidated (NQ)
4113   1058.8706 3173.5900 3173.5728 5.41 1 61 2.9e-006 +1Score > 18 indicates identity U R.VLENAEGDRTTPSIIAYTQDGETLVGQPAK.R + Deamidated (NQ)
4114   1058.8760 3173.6062 3173.5728 10.5 1 50 3.5e-005 +1Score > 18 indicates identity U R.VLENAEGDRTTPSIIAYTQDGETLVGQPAK.R + Deamidated (NQ)
4115   794.4091 3173.6073 3173.5728 10.9 1 44 0.00014 +1Score > 18 indicates identity U R.VLENAEGDRTTPSIIAYTQDGETLVGQPAK.R + Deamidated (NQ)
4116   794.6530 3174.5829 3174.5568 8.22 1 31 0.0029 +1Score > 18 indicates identity U R.VLENAEGDRTTPSIIAYTQDGETLVGQPAK.R + 2 Deamidated (NQ)
4173   682.7523 3408.7251 3408.6910 10.0 1 18 0.053 +1Score > 18 indicates identity U K.NTTIPTKHSQVFSTAEDNQSAVTIHVLQGER.K + Deamidated (NQ)
4174   853.1895 3408.7289 3408.6910 11.1 1 4 1.4 +1Score > 18 indicates identity U K.NTTIPTKHSQVFSTAEDNQSAVTIHVLQGER.K + Deamidated (NQ)
4386   827.3857 4131.8921 4131.8451 11.4 1 27 0.0046 +1Score > 16 indicates identity U K.LMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK.D + 2 Deamidated (NQ); Oxidation (M)
4387   1033.9818 4131.8981 4131.8451 12.8 1 87 5e-009 +1Score > 16 indicates identity U K.LMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK.D + 2 Deamidated (NQ); Oxidation (M)
4388   1034.2271 4132.8793 4132.8291 12.2 1 69 2.3e-007 +1Score > 16 indicates identity U K.LMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK.D + 3 Deamidated (NQ); Oxidation (M)

2 subsets and intersections (3 subset proteins in total)

Score Mass Subset of
UHPB_ECOLI 22 0 1.1
description
FDHD_ECOLI 15 0 1.1
description
1 sameset of FDHD_ECOLI
GAUTC_ARATH 15 0
description

+2

Accession Score Description
1 RHAA_ECOLI 967 L-rhamnose isomerase OS=Escherichia coli (strain K12) GN=rhaA PE=1 SV=2

+3

Accession Score Description
1 ODP2_ECOLI 915 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Escherichia coli (strain K12) GN=aceF PE=1 SV=3

+4

Accession Score Description
1 TKT1_ECOLI 376 Transketolase 1 OS=Escherichia coli (strain K12) GN=tktA PE=1 SV=5

+5

Accession Score Description
1 AMPA_ECOLI 289 Cytosol aminopeptidase OS=Escherichia coli (strain K12) GN=pepA PE=1 SV=1

+6

Accession Score Description
1 TRYP_PIG 261 Trypsin OS=Sus scrofa PE=1 SV=1

+7

Accession Score Description
1 CATNterm_ECOLX 110 Chloramphenicol acetyltransferase with N-terminal tag OS=Escherichia coli GN=cat PE=1 SV=1

+8

Accession Score Description
1 XYLB_ECOLI 81 Xylulose kinase OS=Escherichia coli (strain K12) GN=xylB PE=1 SV=1

+9

Accession Score Description
1 FABZ_ECOLI 73 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ OS=Escherichia coli (strain K12) GN=fabZ PE=1 SV=1

+10

Accession Score Description
1 CH60_ECOLI 69 60 kDa chaperonin OS=Escherichia coli (strain K12) GN=groL PE=1 SV=2
Page: 1 2 3 4 5 Next 

Not what you expected? Try the select summary.