MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1258_JBEI_Tube2_A2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:01 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,668

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 3989)


Page: Previous 1 2 3 4 5 6 7 8 9 10  40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3417 696.6773 2087.0101 2086.9953 7.08 1 1 2.9 +1Score > 18 indicates identity MLDGGDNPLRVQIGSNNIR + 3 Deamidated (NQ); Oxidation (M)
4057 716.8740 2863.4669 2863.4637 1.12 1 1 3.1 +1Score > 19 indicates identity STLMKIIAGITPADSGTLEIEGNNYVR + Deamidated (NQ)
4268 1149.5731 3445.6975 3445.7221 -7.15 0 1 2.6 +1Score > 18 indicates identity AGLTMSDLTLIDMHEAFAAQTLANIQLLGSER + Oxidation (M)
3586 580.3214 2317.2565 2317.2426 6.02 1 1 1.8 +1Score > 16 indicates identity NVTFTTINMPLVKTPMIAPTK + Deamidated (NQ)
2774 485.9577 1454.8513 1454.8279 16.1 1 1 0.76 +1Score > 13 indicates identity LMRLIQANPALSK + Deamidated (NQ)
2820 502.9029 1505.6869 1505.7110 -16.0 1 1 2.8 +1Score > 18 indicates identity LIANRNDDAAFER + 2 Deamidated (NQ)
2455 590.2770 1178.5394 1178.5608 -18.1 0 1 2.1 +1Score > 17 indicates identity GAWLEFDVDK
3237 947.9961 1893.9776 1893.9544 12.3 1 1 3.2 +1Score > 19 indicates identity VHRGDLVVEGNIESNQK + Deamidated (NQ)
3749 638.0541 2548.1873 2548.1971 -3.86 1 1 3.4 +1Score > 19 indicates identity SSSVETMPDLPLKVMMNVGNPDR + 2 Oxidation (M)
2269 525.7671 1049.5196 1049.5294 -9.32 0 1 0.84 +1Score > 20 indicates identity
Score > 13 indicates homology
QWVFSEVR
4476 1088.7531 4350.9833 4350.9208 14.4 0 1 1.9 +1Score > 16 indicates identity MVGQTAQWWLEYHDNQLTSLINNALQNAPDMQVAEQR + 7 Deamidated (NQ); 2 Oxidation (M)
2897 797.9064 1593.7982 1593.8111 -8.03 1 1 3.1 +1Score > 19 indicates identity ALSREYAQLSDVSR
2005 455.2626 908.5106 908.4967 15.3 0 1 1 +1Score > 14 indicates identity IAVSYQTK
2209 336.8547 1007.5423 1007.5287 13.5 1 1 2.4 +1Score > 17 indicates identity EKAEGLYAK
3163 609.9697 1826.8873 1826.8758 6.27 1 1 3.6 +1Score > 19 indicates identity AIDNQIRNISSSHQDK + 2 Deamidated (NQ)
4067 720.8727 2879.4617 2879.4916 -10.4 0 1 3.4 +1Score > 19 indicates identity NLVLDIDYNDAVVVIHTSPGAAQLIAR + 3 Deamidated (NQ)
1653 313.1507 624.2868 624.2867 0.19 0 1 2 +1Score > 16 indicates identity DAYTR
2831 508.9044 1523.6914 1523.6674 15.7 0 1 1.8 +1Score > 16 indicates identity YSQQQLMETSHR + Deamidated (NQ); Oxidation (M)
3206 467.2340 1864.9069 1864.8724 18.5 1 1 3.9 +1Score > 19 indicates identity MSQETPASTTEAQIKNK + 2 Deamidated (NQ)
1690 329.1722 656.3298 656.3242 8.65 0 1 0.99 +1Score > 13 indicates identity QDAAPR
3396 415.2169 2071.0481 2071.0433 2.33 0 1 3.9 +1Score > 19 indicates identity LAQLQVAIQNVTQEQTQR + 4 Deamidated (NQ)
2720 476.5673 1426.6801 1426.6776 1.77 1 1 2.9 +1Score > 18 indicates identity HCVWEEVARNK
1656 314.7124 627.4102 627.4180 -12.4 1 1 1.2 +1Score > 14 indicates identity ARILR
4517 886.8189 4429.0581 4429.0988 -9.18 1 1 2.8 +1Score > 18 indicates identity NTKDEALLDMTAQVLAQEHSQPQLIVLHLMGSHPQACDR + 3 Deamidated (NQ); 2 Oxidation (M)
3109 586.9587 1757.8543 1757.8770 -13.0 1 1 3.4 +1Score > 19 indicates identity LIFMGVEHTQPEKGR + Deamidated (NQ); Oxidation (M)
4107 1004.8757 3011.6053 3011.5491 18.7 0 1 1.6 +1Score > 16 indicates identity QVNIVINNLLYNPQAVAQLLAWLNER + 6 Deamidated (NQ)
2486 599.3047 1196.5948 1196.6077 -10.8 0 1 2.8 +1Score > 18 indicates identity VQFSSAIGPYK + Deamidated (NQ)
2502 605.8079 1209.6012 1209.6063 -4.20 1 1 2.6 +1Score > 18 indicates identity KLAVMNIEYN + Oxidation (M)
3589 775.7261 2324.1565 2324.1120 19.1 1 1 3.5 +1Score > 19 indicates identity SHVWGLFSHPDREMQVINR + Deamidated (NQ); Oxidation (M)
3750 850.7361 2549.1865 2549.1812 2.09 1 1 3.5 +1Score > 19 indicates identity SSSVETMPDLPLKVMMNVGNPDR + Deamidated (NQ); 2 Oxidation (M)
4446 694.8730 4163.1943 4163.1248 16.7 1 1 1.3 +1Score > 15 indicates identity IRALPAAPGVAIAEGWQDATLPLMEQVYQASTLDPALER + 2 Deamidated (NQ)
2899 798.4057 1594.7968 1594.7773 12.3 1 1 3.1 +1Score > 18 indicates identity EMNQQITNYIRGK + Deamidated (NQ)
3153 604.9687 1811.8843 1811.8723 6.59 1 1 3.4 +1Score > 19 indicates identity AAMDRNYLASVLAGSGLS + Deamidated (NQ); Oxidation (M)
1906 409.7149 817.4152 817.4116 4.44 0 1 0.89 +1Score > 20 indicates identity
Score > 13 indicates homology
DAMVGAVR
3337 669.6867 2006.0383 2006.0698 -15.7 1 1 3.4 +1Score > 19 indicates identity GVNVVALYGGQRYDVQLR
2505 606.3170 1210.6194 1210.6016 14.7 0 1 2.9 +1Score > 18 indicates identity VMQAGAAGYLSK + Oxidation (M)
2026 464.2664 926.5182 926.5073 11.9 0 1 1.2 +1Score > 14 indicates identity LAEQPIEK
4124 1018.5356 3052.5850 3052.5678 5.62 0 1 2 +1Score > 16 indicates identity ALAMEPEVLLFDEPTSALDPELVGEVLR
2116 484.2561 966.4976 966.4957 2.05 1 1 2 +1Score > 16 indicates identity LFSGMQRK + Deamidated (NQ)
3341 670.7020 2009.0842 2009.0542 14.9 1 1 2.2 +1Score > 17 indicates identity VHTSKNTLEIVQEGVEAR
4096 492.9330 2951.5543 2951.5651 -3.65 1 1 2.3 +1Score > 17 indicates identity FSIALLNQAVERVHTAIVVQDPTMQR + Oxidation (M)
2896 797.3944 1592.7742 1592.7980 -14.9 1 1 4.1 +1Score > 19 indicates identity LVERYLAEQAMDR
3863 898.7599 2693.2579 2693.2539 1.47 0 1 2.7 +1Score > 18 indicates identity IAWLMSVENCSPYSIMAVTFTNK + 2 Oxidation (M)
2444 390.5388 1168.5946 1168.5876 5.93 0 1 1.9 +1Score > 16 indicates identity QNFELLYSR
3269 646.6993 1937.0761 1937.0442 16.4 1 1 1.7 +1Score > 15 indicates identity VQLAQEGLGIEAQARQAR
3416 522.5154 2086.0325 2086.0596 -13.0 0 1 3.7 +1Score > 19 indicates identity TAAEYQPLIIHYNNGGAVR
3765 856.4301 2566.2685 2566.2461 8.73 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IAIECHSCIQWLTPALENFHK
3696 621.0681 2480.2433 2480.2077 14.3 1 1 3.5 +1Score > 19 indicates identity TTQISARMNNEGAILANEFSASR
2412 383.8453 1148.5141 1148.4954 16.2 0 1 1.5 +1Score > 15 indicates identity VMMNVGNPDR + Deamidated (NQ); Oxidation (M)
2833 509.6044 1525.7914 1525.8180 -17.5 1 1 3.4 +1Score > 18 indicates identity FVIADYFINKAPK + Deamidated (NQ)
3362 506.5102 2022.0117 2022.0204 -4.32 1 1 4.3 +1Score > 20 indicates identity QDVSGFSPVLTVNMRAASK + Oxidation (M)
3394 415.2151 2071.0391 2071.0433 -2.01 0 1 4.3 +1Score > 20 indicates identity LAQLQVAIQNVTQEQTQR + 4 Deamidated (NQ)
4056 716.8727 2863.4617 2863.4637 -0.69 1 1 3.6 +1Score > 19 indicates identity STLMKIIAGITPADSGTLEIEGNNYVR + Deamidated (NQ)
2612 661.8649 1321.7152 1321.7129 1.76 0 1 2 +1Score > 16 indicates identity LISLDTFSQLGK + Deamidated (NQ)
4423 827.2371 4131.1491 4131.1774 -6.83 1 1 1.8 +1Score > 16 indicates identity LVGVTGTNGKTTTTQLLAQWSQLLGEISAVMGTVGNGLLGK + 2 Deamidated (NQ); Oxidation (M)
3369 510.2500 2036.9709 2036.9836 -6.26 1 1 4.1 +1Score > 19 indicates identity APATQEEISEYNKLMASR
3375 681.3671 2041.0795 2041.1109 -15.4 0 1 3.1 +1Score > 18 indicates identity IIGNIHNLQPWLPQELR + Deamidated (NQ)
2565 420.8835 1259.6287 1259.6180 8.50 0 1 3.7 +1Score > 19 indicates identity MQTTQQNAPLK + Deamidated (NQ)
2997 544.6058 1630.7956 1630.8025 -4.23 1 1 3.3 +1Score > 18 indicates identity YGLIGANGSGKSTFMK + Deamidated (NQ)
2727 476.5709 1426.6909 1426.6776 9.34 1 1 4.1 +1Score > 19 indicates identity HCVWEEVARNK
4430 1036.0422 4140.1397 4140.1194 4.90 1 1 1.6 +1Score > 15 indicates identity FQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLK + 3 Deamidated (NQ)
3203 467.2313 1864.8961 1864.9241 -15.0 1 1 3.8 +1Score > 19 indicates identity DLVSVGAYAKGSDPMLDK
3368 509.9997 2035.9697 2035.9884 -9.20 0 1 4.4 +1Score > 20 indicates identity QDFLNSLTVEMLNQDLR + Deamidated (NQ)
2114 484.2131 966.4116 966.4043 7.65 0 1 1.1 +1Score > 13 indicates identity EGAYGNAER + Deamidated (NQ)
2624 446.9033 1337.6881 1337.6683 14.8 1 1 3.6 +1Score > 19 indicates identity LITREMVDSMK + Oxidation (M)
4226 1131.5764 3391.7074 3391.7008 1.94 1 1 3.4 +1Score > 18 indicates identity LGNTLGSDGENLPKAHIVATNPPFGSAAGTNITR + 2 Deamidated (NQ)
2763 725.3665 1448.7184 1448.7293 -7.50 1 1 4.2 +1Score > 19 indicates identity TTQTLKMVAENGR + Deamidated (NQ)
3710 624.3330 2493.3029 2493.2598 17.3 1 1 2.7 +1Score > 17 indicates identity SEQLEQQLQVLLLPKDPDDER + Deamidated (NQ)
4120 1015.5032 3043.4878 3043.5363 -15.9 1 0 3.9 +1Score > 19 indicates identity AYSVGGPGTPVLGPGGQFGATASAAGQRIAEAK + Deamidated (NQ)
3351 672.3359 2013.9859 2013.9578 13.9 1 0 3.8 +1Score > 19 indicates identity QQFRQQTGMTINQYLR + 3 Deamidated (NQ)
3470 724.4293 2170.2661 2170.2296 16.8 1 0 0.9 +1Score > 13 indicates identity MTHIVRFIGLLLLNASSLR + Deamidated (NQ); Oxidation (M)
3386 1030.5277 2059.0408 2059.0639 -11.2 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WLFSFAGAPRPDNPKSIR + Deamidated (NQ)
3097 866.9440 1731.8734 1731.8436 17.2 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
IIADIIAWCSGNMPR + Oxidation (M)
3331 667.3644 1999.0714 1999.1102 -19.4 1 0 3.1 +1Score > 18 indicates identity LLRQQITDPVLFTQAVR + 2 Deamidated (NQ)
3747 848.0840 2541.2302 2541.2281 0.80 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MVAENQPGHIDQIKQTNAGAVYR + 2 Deamidated (NQ)
4459 1062.0105 4244.0129 4243.9494 15.0 1 0 2.3 +1Score > 17 indicates identity STPDFSTAENNQELANEVSCLKAMLTLMLQAMGQADAGR + 2 Oxidation (M)
1564 541.3149 540.3076 540.3020 10.4 0 0 0.91 +1Score > 13 indicates identity VTGHK
3855 897.8106 2690.4100 2690.4465 -13.6 1 0 2.2 +1Score > 16 indicates identity VIQGFGGAALMSVNTALIRLIYPQR + 3 Deamidated (NQ)
3574 1152.0651 2302.1156 2302.0722 18.9 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
FATEGMMQVLADEYQQRLR + Deamidated (NQ); Oxidation (M)
1996 300.1767 897.5083 897.5032 5.66 1 0 1.2 +1Score > 14 indicates identity ALGAPKDAR
4376 617.9980 3701.9443 3701.8875 15.4 1 0 1.5 +1Score > 15 indicates identity LKPQNNLPELISGWRGELMAEALHNLLQEYPQ + Deamidated (NQ)
3473 725.3645 2173.0717 2173.0287 19.8 1 0 4.4 +1Score > 19 indicates identity DLRQAQEILDTDHYGLER + 2 Deamidated (NQ)
4505 735.9055 4409.3893 4409.3655 5.40 1 0 1.1 +1Score > 13 indicates identity QPVGVGDVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTK + 2 Deamidated (NQ); Oxidation (M)
4422 827.2365 4131.1461 4131.1774 -7.56 1 0 1.8 +1Score > 16 indicates identity LVGVTGTNGKTTTTQLLAQWSQLLGEISAVMGTVGNGLLGK + 2 Deamidated (NQ); Oxidation (M)
3083 859.9586 1717.9026 1717.9111 -4.93 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SVRVAVFTQGANAEAAK
3009 819.3834 1636.7522 1636.7766 -14.9 0 0 3.2 +1Score > 18 indicates identity AFGELAMTPQSQALR + 2 Deamidated (NQ); Oxidation (M)
3124 595.9488 1784.8246 1784.8441 -11.0 1 0 3.1 +1Score > 18 indicates identity LEAAAQRFGDGHLNER + 2 Deamidated (NQ)
4566 753.7390 4516.3903 4516.4050 -3.24 1 0 1.1 +1Score > 13 indicates identity GMLGLPFGIADPNFKIQLPPFALSVAVMCLVLAMIIFLPQR + 3 Deamidated (NQ); Oxidation (M)
2868 523.5963 1567.7671 1567.7882 -13.5 1 0 3.5 +1Score > 18 indicates identity IVWSYDSSGVQAKK + Deamidated (NQ)
3432 703.6941 2108.0605 2108.0498 5.07 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GLNNPDLDAAVGEDLAQQLR
3478 1089.5321 2177.0496 2177.0852 -16.3 1 0 4.2 +1Score > 19 indicates identity QVQINNPGDVYTKALDATTK + 2 Deamidated (NQ)
2912 534.2541 1599.7405 1599.7351 3.33 1 0 2.4 +1Score > 17 indicates identity YRGQVNVPDMFTR + 2 Deamidated (NQ); Oxidation (M)
3552 1147.5800 2293.1454 2293.1624 -7.40 0 0 4.2 +1Score > 19 indicates identity LNVIFSCGTGDIVDLSSLDLR
3685 818.7829 2453.3269 2453.3060 8.50 1 0 1.9 +1Score > 16 indicates identity NMQITKILNNNVVVVIDDQQR
2596 433.5747 1297.7023 1297.6779 18.8 0 0 2.3 +1Score > 16 indicates identity AIVALFDHQQR + Deamidated (NQ)
3121 593.6187 1777.8343 1777.8206 7.68 0 0 4 +1Score > 19 indicates identity AVSDSGVPCYFIHGNR
2786 737.8809 1473.7472 1473.7728 -17.4 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QFSPHSFQQLKK
2884 529.6110 1585.8112 1585.7808 19.1 1 0 4.2 +1Score > 19 indicates identity ASQNRDPAATSVAAAR + Deamidated (NQ)
3079 850.4344 1698.8542 1698.8325 12.8 1 0 3.7 +1Score > 18 indicates identity EQNEPVAQVSQWKR + Deamidated (NQ)
3283 652.7054 1955.0944 1955.1091 -7.56 1 0 1.7 +1Score > 15 indicates identity IEKPKGVIVQYGGQTPLK + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9 10  40 Next 

Not what you expected? Try the select summary.