MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1258_JBEI_Tube2_A2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:01 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,668

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 3989)


Page: Previous 1 2 3 4 5 6 7 8 9  40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3354 674.3477 2020.0213 2020.0339 -6.26 0 3 2 +1Score > 18 indicates identity AQIFNFSSGPAMLPAEVLK + Deamidated (NQ)
2103 482.7322 963.4498 963.4410 9.21 0 3 1.4 +1Score > 17 indicates identity EAQAENFR
2618 666.3404 1330.6662 1330.6841 -13.4 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
TRDELNLLDSR
1683 326.6984 651.3822 651.3816 0.96 1 3 0.53 +1Score > 13 indicates identity INRIH
3238 633.6635 1897.9687 1897.9794 -5.64 1 3 2.3 +1Score > 19 indicates identity YKIEFIQMVPTLMNR + Oxidation (M)
1758 350.6864 699.3582 699.3551 4.45 0 3 0.8 +1Score > 14 indicates identity LAPEDR
2090 480.2756 958.5366 958.5447 -8.44 1 3 2.6 +1Score > 19 indicates identity AGGVKVVNSK + Deamidated (NQ)
3817 885.1282 2652.3628 2652.3871 -9.17 1 3 2 +1Score > 18 indicates identity ISLQQRIPGVSIQGASQADELWQK + Deamidated (NQ)
2629 674.3410 1346.6674 1346.6884 -15.5 1 3 2.5 +1Score > 19 indicates identity HIWFDKAQFR
2470 597.3109 1192.6072 1192.6162 -7.52 0 3 2.2 +1Score > 19 indicates identity MGDPLVLTFGK + Oxidation (M)
2499 404.1691 1209.4855 1209.4932 -6.36 0 3 0.54 +1Score > 13 indicates identity QQEMNTQTGR + 2 Deamidated (NQ); Oxidation (M)
1389 432.2468 431.2395 431.2380 3.55 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
GATAL
3377 682.6943 2045.0611 2045.0694 -4.07 1 3 2.7 +1Score > 19 indicates identity NLTLVAGINWPSRVADYR + Deamidated (NQ)
3336 402.2128 2006.0276 2005.9891 19.2 0 3 2.4 +1Score > 19 indicates identity VSLHMHQGSPTQIADAVSK + Deamidated (NQ)
3160 609.6427 1825.9063 1825.9169 -5.85 1 3 2.8 +1Score > 20 indicates identity ENPLQQLLDSNLRQR + 3 Deamidated (NQ)
3363 1012.0176 2022.0206 2021.9979 11.2 1 3 2.7 +1Score > 19 indicates identity AINPLEVEYVRSEMQVK + 2 Deamidated (NQ); Oxidation (M)
1584 561.3015 560.2942 560.2918 4.31 0 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology
ISDAR
2016 458.2218 914.4290 914.4167 13.5 0 3 0.78 +1Score > 14 indicates identity ELEMHEK
2129 486.7911 971.5676 971.5651 2.63 1 3 1.5 +1Score > 17 indicates identity AAKIQEALK + Deamidated (NQ)
2523 613.8603 1225.7060 1225.7255 -15.9 1 3 1.3 +1Score > 16 indicates identity ALLRGVIASGNR
3648 1199.0814 2396.1482 2396.1287 8.17 1 3 2.4 +1Score > 19 indicates identity VMCHDAVEVLHKMIPDNSLR + Deamidated (NQ); 2 Oxidation (M)
3590 776.0585 2325.1537 2325.1205 14.3 1 3 2.4 +1Score > 19 indicates identity MVTNLYQNMRANALADAELR + 2 Oxidation (M)
2825 504.9062 1511.6968 1511.6892 4.99 0 2 1.7 +1Score > 17 indicates identity VAFSGGEFQLNADR + 2 Deamidated (NQ)
3510 745.0475 2232.1207 2232.0878 14.7 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
TVMDNLAEGKQEVMVNGKPR + Deamidated (NQ); Oxidation (M)
4233 852.1678 3404.6421 3404.6485 -1.87 1 2 2.2 +1Score > 18 indicates identity LGAQVDFIGRVGDDDTGNSLLAELESWGVNTR + Deamidated (NQ)
2357 562.7462 1123.4778 1123.4678 8.94 0 2 0.76 +1Score > 14 indicates identity WQEMTGPMK + Deamidated (NQ); Oxidation (M)
2748 717.8663 1433.7180 1433.7184 -0.26 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
VAESLNATLVDMR + Oxidation (M)
3070 837.4676 1672.9206 1672.9108 5.89 1 2 1.3 +1Score > 16 indicates identity VTLSGTEGALDSLRVR
4229 852.1624 3404.6205 3404.6485 -8.21 1 2 2 +1Score > 18 indicates identity LGAQVDFIGRVGDDDTGNSLLAELESWGVNTR + Deamidated (NQ)
3565 767.0735 2298.1987 2298.1743 10.6 0 2 2.4 +1Score > 19 indicates identity GQQLTVSELDVVAFENQPPVK + Deamidated (NQ)
3424 525.2535 2096.9849 2096.9911 -2.96 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
VIPGFMIQGGGFTEQMQQK + 2 Deamidated (NQ)
1728 682.3150 681.3077 681.3082 -0.67 0 2 0.8 +1Score > 14 indicates identity YADSAR
4427 1035.5385 4138.1249 4138.1620 -8.96 1 2 1.1 +1Score > 15 indicates identity ITISGTGYVGLSNGLLIAQNHEVVALDILPSRVAMLNDR + 3 Deamidated (NQ); Oxidation (M)
2633 675.8494 1349.6842 1349.7013 -12.6 1 2 2.7 +1Score > 19 indicates identity SPEVFNLIMKR + Deamidated (NQ); Oxidation (M)
3259 643.3732 1927.0978 1927.0753 11.6 0 2 0.58 +1Score > 13 indicates identity LGTLLLAIACWLLWQR + Deamidated (NQ)
2970 540.6132 1618.8178 1618.7984 11.9 1 2 2.6 +1Score > 19 indicates identity DMSLVNVQALKDNR + Deamidated (NQ); Oxidation (M)
2746 717.8577 1433.7008 1433.7184 -12.3 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
VAESLNATLVDMR + Oxidation (M)
3094 577.3116 1728.9130 1728.9158 -1.66 1 2 2.5 +1Score > 19 indicates identity EQTQLLVAHRYITR + 2 Deamidated (NQ)
2711 712.3608 1422.7070 1422.7103 -2.27 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
ELGIQADVANVHR + 2 Deamidated (NQ)
2715 713.3789 1424.7432 1424.7234 13.9 1 2 1.6 +1Score > 17 indicates identity VEIAPFAYMRGR + Oxidation (M)
3146 905.8992 1809.7838 1809.7951 -6.23 0 2 1.1 +1Score > 15 indicates identity NGYNSAALNGDMNQALR + 2 Deamidated (NQ)
4281 877.7072 3506.7997 3506.7459 15.3 1 2 1.7 +1Score > 17 indicates identity EMEVVDATVQPEKMQTVMQTLLPYLNQALR + 2 Oxidation (M)
1579 560.3156 559.3083 559.3078 0.96 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
RADAK
2622 335.4273 1337.6801 1337.6615 13.9 0 2 2.6 +1Score > 19 indicates identity ESYAFAVLGEPR
3162 913.9684 1825.9222 1825.9250 -1.53 0 2 2.7 +1Score > 19 indicates identity TFQGLILTLQDYWAR + 2 Deamidated (NQ)
3743 847.4183 2539.2331 2539.2410 -3.13 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
QVSKMTRPGEFTVQANSIEMIR + 2 Deamidated (NQ); Oxidation (M)
4612 801.5997 4803.5545 4803.5309 4.92 1 2 0.62 +1Score > 13 indicates identity NFEVLQPLQNSLSGLPLWVSERILQQINQLTHYEPVIGIMGK + 2 Deamidated (NQ)
3665 604.8078 2415.2021 2415.2315 -12.2 1 2 2.7 +1Score > 19 indicates identity QGTLVAINAEKMLTIEDNAEVR + Deamidated (NQ)
2724 357.6785 1426.6849 1426.6776 5.15 1 2 2.5 +1Score > 18 indicates identity HCVWEEVARNK
2726 476.5699 1426.6879 1426.6776 7.23 1 2 2.5 +1Score > 18 indicates identity HCVWEEVARNK
3745 847.4292 2539.2658 2539.2264 15.5 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology
LSDNSQWIQVSLVFQTLQQMR + 3 Deamidated (NQ); Oxidation (M)
2692 706.8656 1411.7166 1411.7242 -5.32 1 2 2 +1Score > 17 indicates identity MNLSQDGIKLHR + Deamidated (NQ)
3413 694.6769 2081.0089 2081.0438 -16.8 0 2 2.7 +1Score > 19 indicates identity AFAAGVTPAQCFEMLALIR + Oxidation (M)
1738 344.2121 686.4096 686.3963 19.5 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology
IAENIK
3345 671.6917 2012.0533 2012.0261 13.5 1 2 2.2 +1Score > 18 indicates identity IRQMPGLNAIEHSNYLR + Deamidated (NQ)
3620 794.3897 2380.1473 2380.1767 -12.4 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology
MVDCFISLQIAGGGDDLQGIKK + Oxidation (M)
3731 841.4066 2521.1980 2521.2079 -3.93 0 2 3.1 +1Score > 19 indicates identity NGGTATTVSMGNGGVLLADSGAAVSGTR + Deamidated (NQ)
4148 787.6185 3146.4449 3146.4583 -4.25 1 2 1.6 +1Score > 16 indicates identity GIYQNWFGFTSLNIYKDDETLEYMAK + Deamidated (NQ)
2827 758.3656 1514.7166 1514.6929 15.7 0 2 2.2 +1Score > 18 indicates identity EIYDGDPGFIFDK
3145 603.9926 1808.9560 1808.9533 1.47 0 2 2 +1Score > 17 indicates identity QHLQADNQVILFLNR + Deamidated (NQ)
3832 535.0836 2670.3816 2670.3397 15.7 1 2 2.5 +1Score > 18 indicates identity DGTMTLVGAPATPHKSPEVFNLIMK + Deamidated (NQ); Oxidation (M)
3689 822.3876 2464.1410 2464.1250 6.48 0 2 2.4 +1Score > 18 indicates identity MTQQDAPLVTAECITLESDWR + Deamidated (NQ)
2219 508.7807 1015.5468 1015.5662 -19.0 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology
QAAKLQTVR + 2 Deamidated (NQ)
2449 587.7971 1173.5796 1173.5877 -6.85 0 2 3.2 +1Score > 19 indicates identity SAQNVVNALEK + 2 Deamidated (NQ)
2172 494.2594 986.5042 986.5080 -3.77 1 2 2.5 +1Score > 18 indicates identity LQPRMGNR + Oxidation (M)
4277 872.6882 3486.7237 3486.6721 14.8 1 2 2.4 +1Score > 18 indicates identity NSVETMMVNLEGVDIPLGMISQYLPKQFER + Deamidated (NQ); 3 Oxidation (M)
2678 697.3691 1392.7236 1392.7473 -17.0 1 2 2.3 +1Score > 18 indicates identity RAVDVHNLAELR + Deamidated (NQ)
4424 1033.7952 4131.1517 4131.2063 -13.2 1 2 1.4 +1Score > 16 indicates identity ASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGK + Deamidated (NQ)
4472 1086.4980 4341.9629 4341.9230 9.19 1 2 1.1 +1Score > 15 indicates identity IDQTGDYNLAYIDQAGSANDASISQGAYGNTAMIIQKGSGNK + 6 Deamidated (NQ); Oxidation (M)
3738 844.4241 2530.2505 2530.2717 -8.39 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology
RLGANVWPLNTVQFSNHTQYGK + Deamidated (NQ)
2652 688.3506 1374.6866 1374.6925 -4.26 1 2 2.8 +1Score > 19 indicates identity MAEISESSIPRR
3385 687.3538 2059.0396 2059.0157 11.6 1 2 0.9 +1Score > 20 indicates identity
Score > 14 indicates homology
VVASMQDPNPQVAGRGLYR + 2 Deamidated (NQ)
3448 709.7115 2126.1127 2126.1266 -6.57 1 2 2.2 +1Score > 18 indicates identity IGVLTSGGDAPGMNAAIRGVVR + Oxidation (M)
2138 488.7316 975.4486 975.4556 -7.11 1 2 1.9 +1Score > 17 indicates identity RCEEINR
2238 515.7884 1029.5622 1029.5455 16.3 0 2 0.87 +1Score > 21 indicates identity
Score > 14 indicates homology
LQDGTLLNR + Deamidated (NQ)
3715 835.7762 2504.3068 2504.3122 -2.15 1 2 2.3 +1Score > 18 indicates identity GHIAGSINLLPSEIKANNVGELEK + 2 Deamidated (NQ)
2180 495.7935 989.5724 989.5579 14.7 0 2 1.2 +1Score > 15 indicates identity LAGTLGMLSK
3706 831.0764 2490.2074 2490.1795 11.2 0 2 3.3 +1Score > 19 indicates identity AQSQADLLDAGSQLQVAALGMLNR + 5 Deamidated (NQ); Oxidation (M)
2100 482.7309 963.4472 963.4661 -19.6 0 2 1.8 +1Score > 17 indicates identity FQEQVNAK + Deamidated (NQ)
2818 753.3731 1504.7316 1504.7384 -4.50 1 2 0.79 +1Score > 20 indicates identity
Score > 13 indicates homology
EAKQFSFNFLMK + Oxidation (M)
2907 533.9207 1598.7403 1598.7722 -20.0 1 2 2 +1Score > 17 indicates identity ESDGITTTGRMLYR
2550 624.2657 1246.5168 1246.5248 -6.38 0 2 0.7 +1Score > 13 indicates identity DQSHLSMEER + Oxidation (M)
3029 415.1913 1656.7361 1656.7599 -14.4 0 2 1.4 +1Score > 15 indicates identity EMAHQQIGMEVLNR + 2 Deamidated (NQ)
3261 965.4799 1928.9452 1928.9744 -15.1 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology
FAPLNSWPDNVSLDKAR
1498 488.2840 487.2767 487.2754 2.67 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology
AQAAK
4025 934.7949 2801.3629 2801.3658 -1.04 0 2 3 +1Score > 19 indicates identity MLLAGMALSTAFTMLLMMLQASGDPR + 2 Oxidation (M)
2270 351.1807 1050.5203 1050.5345 -13.6 0 1 3.2 +1Score > 19 indicates identity FLSANQTLR + 2 Deamidated (NQ)
2806 747.3647 1492.7148 1492.7351 -13.5 1 1 3.1 +1Score > 19 indicates identity TFKNYFDVPPHK + Deamidated (NQ)
4627 1021.1561 5100.7441 5100.7478 -0.72 0 1 0.89 +1Score > 13 indicates identity FIIMMTLTGLALVIIVNAALMSERPIWIISCLMIVLWSGIISHGR + Deamidated (NQ); 3 Oxidation (M)
3967 917.1362 2748.3868 2748.4181 -11.4 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
SQQVIIFDTTLRDGEQALQASLSVK + 2 Deamidated (NQ)
2869 790.8863 1579.7580 1579.7552 1.80 0 1 2.5 +1Score > 18 indicates identity DLFTIDGSAPELMR + Oxidation (M)
4021 932.4420 2794.3042 2794.3120 -2.79 0 1 2.8 +1Score > 18 indicates identity GGAGTFGFSVLQETTHLMENLLDEAR + 2 Deamidated (NQ)
2602 652.3306 1302.6466 1302.6568 -7.78 1 1 3.6 +1Score > 20 indicates identity QQQSVEWLRK + 2 Deamidated (NQ)
2101 482.7310 963.4474 963.4661 -19.4 0 1 2 +1Score > 17 indicates identity FQEQVNAK + Deamidated (NQ)
3184 615.3235 1842.9487 1842.9509 -1.22 0 1 3.6 +1Score > 19 indicates identity LSQQLAMTPQLQQAIR + 2 Deamidated (NQ); Oxidation (M)
2980 406.1794 1620.6885 1620.7170 -17.6 1 1 0.73 +1Score > 13 indicates identity RMGELMAESHASMR + Oxidation (M)
2178 495.7920 989.5694 989.5579 11.6 0 1 1.4 +1Score > 15 indicates identity LAGTLGMLSK
2918 801.9058 1601.7970 1601.8083 -7.03 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
DDVEQRLIDICVK
2832 509.2834 1524.8284 1524.8260 1.56 1 1 1.6 +1Score > 16 indicates identity DLEIRGPGELLGTR
4259 859.1461 3432.5553 3432.6118 -16.5 1 1 2 +1Score > 17 indicates identity RNVGMVFQQYNLWPHLTVQQNLIEAPCR + 6 Deamidated (NQ); Oxidation (M)
Page: Previous 1 2 3 4 5 6 7 8 9  40 Next 

Not what you expected? Try the select summary.