MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1258_JBEI_Tube2_A2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:38:01 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,668

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 3989)


Page: Previous 1 2 3 4 5 6 7 8  40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2488 300.4116 1197.6173 1197.6400 -19.0 1 5 0.77 +1Score > 16 indicates identity RGLRPMAPER + Oxidation (M)
2494 401.8771 1202.6095 1202.6077 1.45 1 5 0.91 +1Score > 20 indicates identity
Score > 17 indicates homology
MNPLLTDSRR + Deamidated (NQ)
1702 335.2063 668.3980 668.4082 -15.1 1 5 0.31 +1Score > 13 indicates identity RIPQR
2496 602.3123 1202.6100 1202.5891 17.4 1 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
NAQQIADRASK + 2 Deamidated (NQ)
2513 407.2340 1218.6802 1218.6761 3.37 0 5 0.73 +1Score > 16 indicates identity YLLLLWGADR
2725 357.6786 1426.6853 1426.6841 0.87 1 5 1.2 +1Score > 18 indicates identity QRFAGYQSEIAR + 2 Deamidated (NQ)
4418 1016.5211 4062.0553 4062.0040 12.6 1 5 0.76 +1Score > 16 indicates identity QQATRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVK + 4 Deamidated (NQ); Oxidation (M)
2475 398.8764 1193.6074 1193.5975 8.27 1 5 1.1 +1Score > 18 indicates identity QIRNMVNFR + Deamidated (NQ); Oxidation (M)
1981 439.7064 877.3982 877.3963 2.17 0 5 0.94 +1Score > 17 indicates identity DLMQQAR + Deamidated (NQ); Oxidation (M)
2431 386.8683 1157.5831 1157.5789 3.61 0 5 1.2 +1Score > 18 indicates identity QDLNVAGQSAR
2062 473.2705 944.5264 944.5113 16.0 0 5 0.88 +1Score > 20 indicates identity
Score > 17 indicates homology
ALAQLLCR + Deamidated (NQ)
2991 814.4007 1626.7868 1626.8188 -19.6 1 5 1.2 +1Score > 18 indicates identity AMQRFLDYVTDLR
2340 372.5098 1114.5076 1114.5216 -12.6 0 5 0.69 +1Score > 16 indicates identity TVDYETLMK + Oxidation (M)
2520 612.3497 1222.6848 1222.6809 3.26 1 5 0.57 +1Score > 15 indicates identity IEIYSKTLEK
2952 539.2521 1614.7345 1614.7105 14.8 1 5 0.7 +1Score > 16 indicates identity MMTRMPQGWSFAR + Deamidated (NQ); Oxidation (M)
1692 329.2066 656.3986 656.3970 2.58 0 5 0.7 +1Score > 16 indicates identity GIVNVR
1988 890.4251 889.4178 889.4141 4.19 0 5 1.3 +1Score > 18 indicates identity ASQLDEAR + Deamidated (NQ)
2593 433.2387 1296.6943 1296.7150 -16.0 1 5 1 +1Score > 17 indicates identity LLGAQPGSQRLR + 2 Deamidated (NQ)
4656 955.4758 6681.2797 6681.2042 11.3 1 5 0.44 +1Score > 14 indicates identity RPIHIILFSLIISAFAYLSVIQYYFNGWQLDSNSVFETAPNKDSNTLFQECSHYYR + 6 Deamidated (NQ)
2066 474.7337 947.4528 947.4712 -19.4 0 5 1.1 +1Score > 18 indicates identity DGNIFAPSK
2621 669.8469 1337.6792 1337.6683 8.19 1 5 1.5 +1Score > 19 indicates identity LITREMVDSMK + Oxidation (M)
2022 306.4992 916.4758 916.4614 15.7 0 5 0.64 +1Score > 20 indicates identity
Score > 15 indicates homology
IANLSGGER + Deamidated (NQ)
2195 500.7893 999.5640 999.5713 -7.26 0 5 1.3 +1Score > 18 indicates identity LGGGTVLQQK
3182 459.9678 1835.8421 1835.8737 -17.2 1 5 1.3 +1Score > 18 indicates identity NDLLDYGNWRMNGLR
3435 528.9954 2111.9525 2111.9799 -13.0 1 5 1.1 +1Score > 17 indicates identity WSEELQSQAWSESIRFK + 2 Deamidated (NQ)
2953 539.2527 1614.7363 1614.7671 -19.1 0 5 0.81 +1Score > 16 indicates identity DSPIQCIQAIAENR + Deamidated (NQ)
1773 357.1628 712.3110 712.3140 -4.14 1 5 0.35 +1Score > 13 indicates identity KNEHGE
2335 557.8101 1113.6056 1113.6030 2.42 0 5 1.4 +1Score > 18 indicates identity IALNIAGDAEK
2577 640.8497 1279.6848 1279.6785 4.93 1 5 0.93 +1Score > 17 indicates identity VLVDWHRAQR + Deamidated (NQ)
3328 498.9936 1991.9453 1991.9696 -12.2 0 4 1.7 +1Score > 19 indicates identity RPVVPGDQMIMEVTFEK + Deamidated (NQ); Oxidation (M)
2607 659.8256 1317.6366 1317.6347 1.50 1 4 1.5 +1Score > 19 indicates identity MQQLEPRADSK + Oxidation (M)
2034 310.5276 928.5610 928.5705 -10.3 1 4 0.72 +1Score > 15 indicates identity LLKSALQR + Deamidated (NQ)
1944 847.4225 846.4152 846.4018 15.9 0 4 1.3 +1Score > 18 indicates identity QACEALR
3533 758.3868 2272.1386 2272.1378 0.36 0 4 1.6 +1Score > 19 indicates identity ATPILMAMGSELINAGGPGMGIR + Oxidation (M)
1784 361.1635 720.3124 720.3225 -13.9 0 4 0.45 +1Score > 13 indicates identity MSNPTR + Oxidation (M)
1503 489.2822 488.2749 488.2707 8.70 0 4 1 +1Score > 21 indicates identity
Score > 17 indicates homology
TAAAR
1739 687.4180 686.4107 686.4075 4.70 0 4 1.2 +1Score > 17 indicates identity AITINR
1929 416.2149 830.4152 830.3995 19.0 1 4 1.9 +1Score > 19 indicates identity RGEGGAQR + Deamidated (NQ)
2218 507.7920 1013.5694 1013.5869 -17.2 1 4 1.7 +1Score > 19 indicates identity LAGDLIKQR + Deamidated (NQ)
2067 474.7341 947.4536 947.4672 -14.3 1 4 1.3 +1Score > 18 indicates identity DGKVTSDAR
1954 428.7675 855.5204 855.5290 -9.99 1 4 0.89 +1Score > 16 indicates identity IANRLLR + Deamidated (NQ)
2979 541.2364 1620.6874 1620.7170 -18.3 1 4 0.39 +1Score > 13 indicates identity RMGELMAESHASMR + Oxidation (M)
2013 457.7514 913.4882 913.4729 16.8 1 4 0.8 +1Score > 16 indicates identity KPRQNNR + 2 Deamidated (NQ)
1904 409.6942 817.3738 817.3831 -11.3 1 4 0.43 +1Score > 13 indicates identity WRADNR + Deamidated (NQ)
2064 474.7333 947.4520 947.4494 2.74 0 4 1.2 +1Score > 17 indicates identity MGSQELQR
3383 687.3521 2059.0345 2059.0408 -3.07 0 4 0.68 +1Score > 20 indicates identity
Score > 15 indicates homology
LEAMLPGYTAALATQPAEGR
2258 521.8007 1041.5868 1041.6070 -19.3 0 4 1.3 +1Score > 18 indicates identity IQAIIEDIK
2525 613.8613 1225.7080 1225.7255 -14.2 1 4 0.87 +1Score > 16 indicates identity ALLRGVIASGNR
2328 369.5262 1105.5568 1105.5437 11.8 0 4 1.8 +1Score > 19 indicates identity QQETAVATMK
1916 412.7539 823.4932 823.4817 14.0 1 4 0.4 +1Score > 13 indicates identity VWHVKR
2068 474.7351 947.4556 947.4746 -20.0 0 4 1.4 +1Score > 18 indicates identity VAGEMNLSK
2791 494.6047 1480.7923 1480.7634 19.5 0 4 1.4 +1Score > 18 indicates identity AAATQHNLEVLASR + Deamidated (NQ)
3348 671.6986 2012.0740 2012.0367 18.5 0 4 1.3 +1Score > 17 indicates identity AAYDAGAIYGGLIFVATSPR
2128 486.2156 970.4166 970.4212 -4.68 1 4 0.4 +1Score > 13 indicates identity DSMSMKTR + Oxidation (M)
2700 708.3633 1414.7120 1414.7357 -16.8 0 4 1.7 +1Score > 19 indicates identity VTQDHFWLTLR
2701 708.3869 1414.7592 1414.7602 -0.67 1 4 1.7 +1Score > 19 indicates identity MTTNPRELLIAR + Deamidated (NQ)
2324 551.7850 1101.5554 1101.5414 12.7 1 4 1.3 +1Score > 17 indicates identity LADEENQKR
2033 465.2584 928.5022 928.5090 -7.28 1 4 1.5 +1Score > 18 indicates identity DRIQQLR + Deamidated (NQ)
2623 335.4280 1337.6829 1337.6827 0.15 0 4 1.8 +1Score > 19 indicates identity YIIGIDGGSQSTK
1852 391.6960 781.3774 781.3793 -2.32 0 4 0.65 +1Score > 14 indicates identity YPVMTR + Oxidation (M)
2495 401.8772 1202.6098 1202.5979 9.90 1 4 0.56 +1Score > 20 indicates identity
Score > 14 indicates homology
DVVGHSFRMR
3360 674.6965 2021.0677 2021.0907 -11.4 0 4 1.2 +1Score > 17 indicates identity EWVMLDIYLVGIGVASIK + Oxidation (M)
1732 685.3527 684.3454 684.3555 -14.7 0 4 0.73 +1Score > 15 indicates identity AGADPVR
1689 657.3364 656.3291 656.3170 18.5 0 3 0.52 +1Score > 13 indicates identity FESFK
1528 504.2792 503.2719 503.2816 -19.2 1 3 0.88 +1Score > 22 indicates identity
Score > 15 indicates homology
KSGGR
3646 799.4008 2395.1806 2395.1552 10.6 1 3 1.9 +1Score > 19 indicates identity FGEAVAAWEMMLKLLPANDTR + Deamidated (NQ); 2 Oxidation (M)
3467 721.7126 2162.1160 2162.0902 11.9 1 3 1.6 +1Score > 18 indicates identity VTNLYQNMRANALADAELR
2716 713.3815 1424.7484 1424.7234 17.6 1 3 1.2 +1Score > 17 indicates identity VEIAPFAYMRGR + Oxidation (M)
1502 489.2819 488.2746 488.2707 8.09 0 3 0.61 +1Score > 21 indicates identity
Score > 14 indicates homology
TAAAR
3229 629.3373 1884.9901 1884.9581 16.9 1 3 1.7 +1Score > 18 indicates identity KVTQLVNVEEHVEGFR + 2 Deamidated (NQ)
3126 449.2137 1792.8257 1792.8591 -18.6 1 3 1.6 +1Score > 18 indicates identity DLNDAQLKYASDVEGR
2115 967.4192 966.4119 966.4043 7.94 0 3 0.57 +1Score > 13 indicates identity EGAYGNAER + Deamidated (NQ)
2747 717.8580 1433.7014 1433.7184 -11.8 1 3 0.84 +1Score > 20 indicates identity
Score > 15 indicates homology
QGLGQSKNVVMVR + 3 Deamidated (NQ); Oxidation (M)
2102 482.7321 963.4496 963.4661 -17.1 0 3 1.3 +1Score > 17 indicates identity FQEQVNAK + Deamidated (NQ)
2355 374.8644 1121.5714 1121.5717 -0.27 0 3 2.2 +1Score > 19 indicates identity NLPTGTYSLR + Deamidated (NQ)
2119 484.2570 966.4994 966.5174 -18.6 0 3 1.2 +1Score > 17 indicates identity LASLYSWK
2290 534.2991 1066.5836 1066.5658 16.7 0 3 0.73 +1Score > 14 indicates identity QLLHNALEK + 2 Deamidated (NQ)
1980 878.4055 877.3982 877.3963 2.14 0 3 1.4 +1Score > 17 indicates identity DLMQQAR + Deamidated (NQ); Oxidation (M)
2875 791.3868 1580.7590 1580.7583 0.45 1 3 1.8 +1Score > 18 indicates identity VVYDSVGRDTWER
2243 517.7878 1033.5610 1033.5556 5.24 0 3 1.8 +1Score > 18 indicates identity LAQGEFLTR
3707 416.2071 2491.1989 2491.2060 -2.82 0 3 2.4 +1Score > 19 indicates identity WFVEGLTPNNPYTYSTIGYIR + Deamidated (NQ)
3256 964.5494 1927.0842 1927.0753 4.63 0 3 0.5 +1Score > 13 indicates identity LGTLLLAIACWLLWQR + Deamidated (NQ)
2893 530.2505 1587.7297 1587.7583 -18.0 1 3 1.6 +1Score > 17 indicates identity DKVSQAFWHEWR
3892 905.4906 2713.4500 2713.4439 2.23 1 3 0.93 +1Score > 15 indicates identity GVVLWFTGLSGSGKSTVAGALEEALHK
2293 358.8292 1073.4658 1073.4852 -18.1 0 3 0.5 +1Score > 13 indicates identity NMSAFVDYK
1576 559.3229 558.3156 558.3125 5.54 0 3 0.56 +1Score > 22 indicates identity
Score > 13 indicates homology
AAELR
2421 578.3229 1154.6312 1154.6481 -14.6 0 3 1 +1Score > 16 indicates identity IGAIMVPINAR + Deamidated (NQ)
3869 675.6100 2698.4109 2698.3735 13.9 0 3 1.5 +1Score > 17 indicates identity LLQVGGNMLLLDEPTNDLDIETLR + Deamidated (NQ); Oxidation (M)
1506 490.2632 489.2559 489.2547 2.53 0 3 2.3 +1Score > 19 indicates identity ANSAK
2354 374.8633 1121.5681 1121.5573 9.62 0 3 2.4 +1Score > 19 indicates identity MSKPIVMER + 2 Oxidation (M)
2232 342.1814 1023.5224 1023.5138 8.40 0 3 1.8 +1Score > 18 indicates identity AQFDQFLR
1684 326.6989 651.3832 651.3816 2.50 1 3 0.52 +1Score > 13 indicates identity INRIH
3148 604.2864 1809.8374 1809.8535 -8.94 1 3 1.9 +1Score > 18 indicates identity MTGRLALVMGAEGEGMR + 2 Oxidation (M)
2285 355.5231 1063.5475 1063.5549 -7.03 0 3 2 +1Score > 18 indicates identity VLEYNLAGGK + Deamidated (NQ)
3464 721.0474 2160.1204 2160.1096 5.00 1 3 2.3 +1Score > 19 indicates identity MSRVETIINELSLIASNPR + 2 Deamidated (NQ); Oxidation (M)
2296 1074.5690 1073.5617 1073.5604 1.22 0 3 0.89 +1Score > 20 indicates identity
Score > 15 indicates homology
DLNLALQSAK + 2 Deamidated (NQ)
3180 610.6891 1829.0455 1829.0518 -3.47 1 3 0.52 +1Score > 13 indicates identity MDIKVMLGLDALILLR + Oxidation (M)
3384 687.3525 2059.0357 2059.0408 -2.48 0 3 0.69 +1Score > 20 indicates identity
Score > 14 indicates homology
LEAMLPGYTAALATQPAEGR
3717 837.4462 2509.3168 2509.3064 4.14 1 3 1.7 +1Score > 18 indicates identity VKEFGPLIVSIDTHGNNLIAENK + 2 Deamidated (NQ)
3099 581.9803 1742.9191 1742.9414 -12.8 0 3 2 +1Score > 18 indicates identity QGATVIAITSLTDSPLR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8  40 Next 

Not what you expected? Try the select summary.