MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1258_JBEI_Tube2_A2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:35:06 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,668

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 501–600 (out of 3989)

Page: Previous 1 2 3 4 5 6 7 8 9 10 11 … 40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3275 647.6687 1939.9843 1939.9680 8.41 0 0 3.7 +1Score > 18 indicates identity YGIAVIEDAAHAVGTYYK
3777 862.7750 2585.3032 2585.3271 -9.27 1 0 4.6 +1Score > 19 indicates identity MLASASRERPGYTAGVAAPDLLDPK
3185 615.6367 1843.8883 1843.8986 -5.58 1 0 3.2 +1Score > 18 indicates identity GLNVEVNDPELVDMRK + Deamidated (NQ); Oxidation (M)
3004 818.3946 1634.7746 1634.7933 -11.4 1 0 4.1 +1Score > 19 indicates identity QAGAEMTELSTNVKR + Deamidated (NQ)
4232 1135.8860 3404.6362 3404.6485 -3.61 1 0 3.7 +1Score > 18 indicates identity LGAQVDFIGRVGDDDTGNSLLAELESWGVNTR + Deamidated (NQ)
4596 775.2077 4645.2025 4645.1671 7.63 1 0 3 +1Score > 17 indicates identity FGRNAMVNMGSISMVDAVYTDAPPPVSVMQVLTDHHIQLELC + 3 Deamidated (NQ)
2864 783.4020 1564.7894 1564.7621 17.5 0 0 4.1 +1Score > 19 indicates identity FNIDSTQVSLTPDK + Deamidated (NQ)
4473 1086.5001 4341.9713 4341.9230 11.1 1 0 2 +1Score > 16 indicates identity IDQTGDYNLAYIDQAGSANDASISQGAYGNTAMIIQKGSGNK + 6 Deamidated (NQ); Oxidation (M)
2483 598.2607 1194.5068 1194.5009 5.00 0 0 1 +1Score > 13 indicates identity QMQMNAQAEK + Deamidated (NQ); Oxidation (M)
2497 603.7990 1205.5834 1205.6040 -17.1 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 IQEGVVDYGAR
2982 406.1797 1620.6897 1620.7170 -16.9 1 0 0.99 +1Score > 13 indicates identity RMGELMAESHASMR + Oxidation (M)
3426 525.7656 2099.0333 2098.9915 19.9 0 0 4.5 +1Score > 19 indicates identity MDQTLAVYQQILTSMPSR + 2 Deamidated (NQ); Oxidation (M)
3062 558.5728 1672.6966 1672.6742 13.4 0 0 0.99 +1Score > 13 indicates identity LMSMQGQACQQLSR + 4 Deamidated (NQ); 2 Oxidation (M)
3270 646.7013 1937.0821 1937.0442 19.5 1 0 1.7 +1Score > 15 indicates identity VQLAQEGLGIEAQARQAR
1 300.0301 299.0228
2 300.0307 299.0234
3 300.1811 299.1738
4 300.1814 299.1741
5 300.1816 299.1743
6 300.1823 299.1750
7 301.0601 300.0528
8 301.0858 300.0785
9 301.1306 300.1233
10 301.1886 300.1813
11 301.1890 300.1817
12 301.2211 300.2138
13 301.8895 300.8822
14 301.8896 300.8823
15 301.8897 300.8824
16 301.8900 300.8827
17 301.8902 300.8829
18 301.9109 300.9036
19 302.0094 301.0021
20 302.1968 301.1895
21 302.1969 301.1896
22 302.1973 301.1900
23 302.1977 301.1904
24 302.8698 301.8625
25 302.9912 301.9839
26 303.0757 302.0684
27 303.0851 302.0778
28 303.1029 302.0956
29 303.1210 302.1137
30 303.1213 302.1140
31 303.1215 302.1142
32 303.1223 302.1150
33 303.1777 302.1704
34 303.1785 302.1712
35 303.8843 302.8770
36 303.8843 302.8770
37 303.8844 302.8771
38 303.8844 302.8771
39 303.8844 302.8771
40 303.8844 302.8771
41 303.8846 302.8773
42 303.8846 302.8773
43 303.8847 302.8774
44 303.8848 302.8775
45 303.8848 302.8775
46 303.8849 302.8776
47 303.8849 302.8776
48 303.8850 302.8777
49 303.8850 302.8777
50 303.8851 302.8778
51 303.8851 302.8778
52 303.8852 302.8779
53 303.8853 302.8780
54 303.8853 302.8780
55 303.8856 302.8783
56 303.8857 302.8784
57 303.8857 302.8784
58 303.8858 302.8785
59 303.8859 302.8786
60 303.8859 302.8786
61 303.8860 302.8787
62 303.8862 302.8789
63 303.8864 302.8791
64 303.8865 302.8792
65 304.0654 303.0581
66 304.0661 303.0588
67 304.1765 303.1692
68 304.1767 303.1694
69 304.1768 303.1695
70 304.1771 303.1698
71 305.0070 303.9997
72 305.0070 303.9997
73 305.0074 304.0001
74 305.0983 304.0910
75 305.0984 304.0911
76 305.0997 304.0924
77 305.1007 304.0934
78 305.1009 304.0936
79 305.1366 304.1293
80 305.1367 304.1294
81 305.1368 304.1295
82 305.1369 304.1296
83 305.1369 304.1296
84 305.1369 304.1296
85 305.1370 304.1297
86 305.1375 304.1302
Page: Previous 1 2 3 4 5 6 7 8 9 10 11 … 40 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/