MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 2 |
| MS data file | : | PRT1258_JBEI_Tube2_A2.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 24 Jun 2025 at 18:35:06 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,668 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2488 |
300.4116 | 1197.6173 | 1197.6400 | -19.0 | 1 | 5 | 0.77 | 1Score > 16 indicates identity |
RGLRPMAPER + Oxidation (M) |
| 2494 |
401.8771 | 1202.6095 | 1202.6077 | 1.45 | 1 | 5 | 0.91 | 1Score > 20 indicates identity Score > 17 indicates homology |
MNPLLTDSRR + Deamidated (NQ) |
| 1702 |
335.2063 | 668.3980 | 668.4082 | -15.1 | 1 | 5 | 0.31 | 1Score > 13 indicates identity |
RIPQR |
| 2496 |
602.3123 | 1202.6100 | 1202.5891 | 17.4 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
NAQQIADRASK + 2 Deamidated (NQ) |
| 2513 |
407.2340 | 1218.6802 | 1218.6761 | 3.37 | 0 | 5 | 0.73 | 1Score > 16 indicates identity |
YLLLLWGADR |
| 2725 |
357.6786 | 1426.6853 | 1426.6841 | 0.87 | 1 | 5 | 1.2 | 1Score > 18 indicates identity |
QRFAGYQSEIAR + 2 Deamidated (NQ) |
| 4418 |
1016.5211 | 4062.0553 | 4062.0040 | 12.6 | 1 | 5 | 0.76 | 1Score > 16 indicates identity |
QQATRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVK + 4 Deamidated (NQ); Oxidation (M) |
| 2475 |
398.8764 | 1193.6074 | 1193.5975 | 8.27 | 1 | 5 | 1.1 | 1Score > 18 indicates identity |
QIRNMVNFR + Deamidated (NQ); Oxidation (M) |
| 1981 |
439.7064 | 877.3982 | 877.3963 | 2.17 | 0 | 5 | 0.94 | 1Score > 17 indicates identity |
DLMQQAR + Deamidated (NQ); Oxidation (M) |
| 2431 |
386.8683 | 1157.5831 | 1157.5789 | 3.61 | 0 | 5 | 1.2 | 1Score > 18 indicates identity |
QDLNVAGQSAR |
| 2062 |
473.2705 | 944.5264 | 944.5113 | 16.0 | 0 | 5 | 0.88 | 1Score > 20 indicates identity Score > 17 indicates homology |
ALAQLLCR + Deamidated (NQ) |
| 2991 |
814.4007 | 1626.7868 | 1626.8188 | -19.6 | 1 | 5 | 1.2 | 1Score > 18 indicates identity |
AMQRFLDYVTDLR |
| 2340 |
372.5098 | 1114.5076 | 1114.5216 | -12.6 | 0 | 5 | 0.69 | 1Score > 16 indicates identity |
TVDYETLMK + Oxidation (M) |
| 2520 |
612.3497 | 1222.6848 | 1222.6809 | 3.26 | 1 | 5 | 0.57 | 1Score > 15 indicates identity |
IEIYSKTLEK |
| 2952 |
539.2521 | 1614.7345 | 1614.7105 | 14.8 | 1 | 5 | 0.7 | 1Score > 16 indicates identity |
MMTRMPQGWSFAR + Deamidated (NQ); Oxidation (M) |
| 1692 |
329.2066 | 656.3986 | 656.3970 | 2.58 | 0 | 5 | 0.7 | 1Score > 16 indicates identity |
GIVNVR |
| 1988 |
890.4251 | 889.4178 | 889.4141 | 4.19 | 0 | 5 | 1.3 | 1Score > 18 indicates identity |
ASQLDEAR + Deamidated (NQ) |
| 2593 |
433.2387 | 1296.6943 | 1296.7150 | -16.0 | 1 | 5 | 1 | 1Score > 17 indicates identity |
LLGAQPGSQRLR + 2 Deamidated (NQ) |
| 4656 |
955.4758 | 6681.2797 | 6681.2042 | 11.3 | 1 | 5 | 0.44 | 1Score > 14 indicates identity |
RPIHIILFSLIISAFAYLSVIQYYFNGWQLDSNSVFETAPNKDSNTLFQECSHYYR + 6 Deamidated (NQ) |
| 2066 |
474.7337 | 947.4528 | 947.4712 | -19.4 | 0 | 5 | 1.1 | 1Score > 18 indicates identity |
DGNIFAPSK |
| 2621 |
669.8469 | 1337.6792 | 1337.6683 | 8.19 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
LITREMVDSMK + Oxidation (M) |
| 2022 |
306.4992 | 916.4758 | 916.4614 | 15.7 | 0 | 5 | 0.64 | 1Score > 20 indicates identity Score > 15 indicates homology |
IANLSGGER + Deamidated (NQ) |
| 2195 |
500.7893 | 999.5640 | 999.5713 | -7.26 | 0 | 5 | 1.3 | 1Score > 18 indicates identity |
LGGGTVLQQK |
| 3182 |
459.9678 | 1835.8421 | 1835.8737 | -17.2 | 1 | 5 | 1.3 | 1Score > 18 indicates identity |
NDLLDYGNWRMNGLR |
| 3435 |
528.9954 | 2111.9525 | 2111.9799 | -13.0 | 1 | 5 | 1.1 | 1Score > 17 indicates identity |
WSEELQSQAWSESIRFK + 2 Deamidated (NQ) |
| 2953 |
539.2527 | 1614.7363 | 1614.7671 | -19.1 | 0 | 5 | 0.81 | 1Score > 16 indicates identity |
DSPIQCIQAIAENR + Deamidated (NQ) |
| 1773 |
357.1628 | 712.3110 | 712.3140 | -4.14 | 1 | 5 | 0.35 | 1Score > 13 indicates identity |
KNEHGE |
| 2335 |
557.8101 | 1113.6056 | 1113.6030 | 2.42 | 0 | 5 | 1.4 | 1Score > 18 indicates identity |
IALNIAGDAEK |
| 2577 |
640.8497 | 1279.6848 | 1279.6785 | 4.93 | 1 | 5 | 0.93 | 1Score > 17 indicates identity |
VLVDWHRAQR + Deamidated (NQ) |
| 3328 |
498.9936 | 1991.9453 | 1991.9696 | -12.2 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
RPVVPGDQMIMEVTFEK + Deamidated (NQ); Oxidation (M) |
| 2607 |
659.8256 | 1317.6366 | 1317.6347 | 1.50 | 1 | 4 | 1.5 | 1Score > 19 indicates identity |
MQQLEPRADSK + Oxidation (M) |
| 2034 |
310.5276 | 928.5610 | 928.5705 | -10.3 | 1 | 4 | 0.72 | 1Score > 15 indicates identity |
LLKSALQR + Deamidated (NQ) |
| 1944 |
847.4225 | 846.4152 | 846.4018 | 15.9 | 0 | 4 | 1.3 | 1Score > 18 indicates identity |
QACEALR |
| 3533 |
758.3868 | 2272.1386 | 2272.1378 | 0.36 | 0 | 4 | 1.6 | 1Score > 19 indicates identity |
ATPILMAMGSELINAGGPGMGIR + Oxidation (M) |
| 1784 |
361.1635 | 720.3124 | 720.3225 | -13.9 | 0 | 4 | 0.45 | 1Score > 13 indicates identity |
MSNPTR + Oxidation (M) |
| 1503 |
489.2822 | 488.2749 | 488.2707 | 8.70 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
TAAAR |
| 1739 |
687.4180 | 686.4107 | 686.4075 | 4.70 | 0 | 4 | 1.2 | 1Score > 17 indicates identity |
AITINR |
| 1929 |
416.2149 | 830.4152 | 830.3995 | 19.0 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
RGEGGAQR + Deamidated (NQ) |
| 2218 |
507.7920 | 1013.5694 | 1013.5869 | -17.2 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
LAGDLIKQR + Deamidated (NQ) |
| 2067 |
474.7341 | 947.4536 | 947.4672 | -14.3 | 1 | 4 | 1.3 | 1Score > 18 indicates identity |
DGKVTSDAR |
| 1954 |
428.7675 | 855.5204 | 855.5290 | -9.99 | 1 | 4 | 0.89 | 1Score > 16 indicates identity |
IANRLLR + Deamidated (NQ) |
| 2979 |
541.2364 | 1620.6874 | 1620.7170 | -18.3 | 1 | 4 | 0.39 | 1Score > 13 indicates identity |
RMGELMAESHASMR + Oxidation (M) |
| 2013 |
457.7514 | 913.4882 | 913.4729 | 16.8 | 1 | 4 | 0.8 | 1Score > 16 indicates identity |
KPRQNNR + 2 Deamidated (NQ) |
| 1904 |
409.6942 | 817.3738 | 817.3831 | -11.3 | 1 | 4 | 0.43 | 1Score > 13 indicates identity |
WRADNR + Deamidated (NQ) |
| 2064 |
474.7333 | 947.4520 | 947.4494 | 2.74 | 0 | 4 | 1.2 | 1Score > 17 indicates identity |
MGSQELQR |
| 2258 |
521.8007 | 1041.5868 | 1041.6070 | -19.3 | 0 | 4 | 1.3 | 1Score > 18 indicates identity |
IQAIIEDIK |
| 3383 |
687.3521 | 2059.0345 | 2059.0408 | -3.07 | 0 | 4 | 0.68 | 1Score > 20 indicates identity Score > 15 indicates homology |
LEAMLPGYTAALATQPAEGR |
| 2525 |
613.8613 | 1225.7080 | 1225.7255 | -14.2 | 1 | 4 | 0.87 | 1Score > 16 indicates identity |
ALLRGVIASGNR |
| 2328 |
369.5262 | 1105.5568 | 1105.5437 | 11.8 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
QQETAVATMK |
| 1916 |
412.7539 | 823.4932 | 823.4817 | 14.0 | 1 | 4 | 0.4 | 1Score > 13 indicates identity |
VWHVKR |
| 2068 |
474.7351 | 947.4556 | 947.4746 | -20.0 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
VAGEMNLSK |
| 2791 |
494.6047 | 1480.7923 | 1480.7634 | 19.5 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
AAATQHNLEVLASR + Deamidated (NQ) |
| 3348 |
671.6986 | 2012.0740 | 2012.0367 | 18.5 | 0 | 4 | 1.3 | 1Score > 17 indicates identity |
AAYDAGAIYGGLIFVATSPR |
| 2128 |
486.2156 | 970.4166 | 970.4212 | -4.68 | 1 | 4 | 0.4 | 1Score > 13 indicates identity |
DSMSMKTR + Oxidation (M) |
| 2700 |
708.3633 | 1414.7120 | 1414.7357 | -16.8 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
VTQDHFWLTLR |
| 2701 |
708.3869 | 1414.7592 | 1414.7602 | -0.67 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
MTTNPRELLIAR + Deamidated (NQ) |
| 2324 |
551.7850 | 1101.5554 | 1101.5414 | 12.7 | 1 | 4 | 1.3 | 1Score > 17 indicates identity |
LADEENQKR |
| 2033 |
465.2584 | 928.5022 | 928.5090 | -7.28 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
DRIQQLR + Deamidated (NQ) |
| 2623 |
335.4280 | 1337.6829 | 1337.6827 | 0.15 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
YIIGIDGGSQSTK |
| 1852 |
391.6960 | 781.3774 | 781.3793 | -2.32 | 0 | 4 | 0.65 | 1Score > 14 indicates identity |
YPVMTR + Oxidation (M) |
| 2495 |
401.8772 | 1202.6098 | 1202.5979 | 9.90 | 1 | 4 | 0.56 | 1Score > 20 indicates identity Score > 14 indicates homology |
DVVGHSFRMR |
| 3360 |
674.6965 | 2021.0677 | 2021.0907 | -11.4 | 0 | 4 | 1.2 | 1Score > 17 indicates identity |
EWVMLDIYLVGIGVASIK + Oxidation (M) |
| 1732 |
685.3527 | 684.3454 | 684.3555 | -14.7 | 0 | 4 | 0.73 | 1Score > 15 indicates identity |
AGADPVR |
| 1689 |
657.3364 | 656.3291 | 656.3170 | 18.5 | 0 | 3 | 0.52 | 1Score > 13 indicates identity |
FESFK |
| 1528 |
504.2792 | 503.2719 | 503.2816 | -19.2 | 1 | 3 | 0.88 | 1Score > 22 indicates identity Score > 15 indicates homology |
KSGGR |
| 3646 |
799.4008 | 2395.1806 | 2395.1552 | 10.6 | 1 | 3 | 1.9 | 1Score > 19 indicates identity |
FGEAVAAWEMMLKLLPANDTR + Deamidated (NQ); 2 Oxidation (M) |
| 3467 |
721.7126 | 2162.1160 | 2162.0902 | 11.9 | 1 | 3 | 1.6 | 1Score > 18 indicates identity |
VTNLYQNMRANALADAELR |
| 2716 |
713.3815 | 1424.7484 | 1424.7234 | 17.6 | 1 | 3 | 1.2 | 1Score > 17 indicates identity |
VEIAPFAYMRGR + Oxidation (M) |
| 1502 |
489.2819 | 488.2746 | 488.2707 | 8.09 | 0 | 3 | 0.61 | 1Score > 21 indicates identity Score > 14 indicates homology |
TAAAR |
| 3229 |
629.3373 | 1884.9901 | 1884.9581 | 16.9 | 1 | 3 | 1.7 | 1Score > 18 indicates identity |
KVTQLVNVEEHVEGFR + 2 Deamidated (NQ) |
| 3126 |
449.2137 | 1792.8257 | 1792.8591 | -18.6 | 1 | 3 | 1.6 | 1Score > 18 indicates identity |
DLNDAQLKYASDVEGR |
| 2115 |
967.4192 | 966.4119 | 966.4043 | 7.94 | 0 | 3 | 0.57 | 1Score > 13 indicates identity |
EGAYGNAER + Deamidated (NQ) |
| 2747 |
717.8580 | 1433.7014 | 1433.7184 | -11.8 | 1 | 3 | 0.84 | 1Score > 20 indicates identity Score > 15 indicates homology |
QGLGQSKNVVMVR + 3 Deamidated (NQ); Oxidation (M) |
| 2102 |
482.7321 | 963.4496 | 963.4661 | -17.1 | 0 | 3 | 1.3 | 1Score > 17 indicates identity |
FQEQVNAK + Deamidated (NQ) |
| 2355 |
374.8644 | 1121.5714 | 1121.5717 | -0.27 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
NLPTGTYSLR + Deamidated (NQ) |
| 2119 |
484.2570 | 966.4994 | 966.5174 | -18.6 | 0 | 3 | 1.2 | 1Score > 17 indicates identity |
LASLYSWK |
| 2290 |
534.2991 | 1066.5836 | 1066.5658 | 16.7 | 0 | 3 | 0.73 | 1Score > 14 indicates identity |
QLLHNALEK + 2 Deamidated (NQ) |
| 1980 |
878.4055 | 877.3982 | 877.3963 | 2.14 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
DLMQQAR + Deamidated (NQ); Oxidation (M) |
| 2875 |
791.3868 | 1580.7590 | 1580.7583 | 0.45 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
VVYDSVGRDTWER |
| 2243 |
517.7878 | 1033.5610 | 1033.5556 | 5.24 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
LAQGEFLTR |
| 3707 |
416.2071 | 2491.1989 | 2491.2060 | -2.82 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
WFVEGLTPNNPYTYSTIGYIR + Deamidated (NQ) |
| 3256 |
964.5494 | 1927.0842 | 1927.0753 | 4.63 | 0 | 3 | 0.5 | 1Score > 13 indicates identity |
LGTLLLAIACWLLWQR + Deamidated (NQ) |
| 2893 |
530.2505 | 1587.7297 | 1587.7583 | -18.0 | 1 | 3 | 1.6 | 1Score > 17 indicates identity |
DKVSQAFWHEWR |
| 3892 |
905.4906 | 2713.4500 | 2713.4439 | 2.23 | 1 | 3 | 0.93 | 1Score > 15 indicates identity |
GVVLWFTGLSGSGKSTVAGALEEALHK |
| 2293 |
358.8292 | 1073.4658 | 1073.4852 | -18.1 | 0 | 3 | 0.5 | 1Score > 13 indicates identity |
NMSAFVDYK |
| 1576 |
559.3229 | 558.3156 | 558.3125 | 5.54 | 0 | 3 | 0.56 | 1Score > 22 indicates identity Score > 13 indicates homology |
AAELR |
| 2421 |
578.3229 | 1154.6312 | 1154.6481 | -14.6 | 0 | 3 | 1 | 1Score > 16 indicates identity |
IGAIMVPINAR + Deamidated (NQ) |
| 3869 |
675.6100 | 2698.4109 | 2698.3735 | 13.9 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
LLQVGGNMLLLDEPTNDLDIETLR + Deamidated (NQ); Oxidation (M) |
| 1506 |
490.2632 | 489.2559 | 489.2547 | 2.53 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
ANSAK |
| 2354 |
374.8633 | 1121.5681 | 1121.5573 | 9.62 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
MSKPIVMER + 2 Oxidation (M) |
| 2232 |
342.1814 | 1023.5224 | 1023.5138 | 8.40 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
AQFDQFLR |
| 1684 |
326.6989 | 651.3832 | 651.3816 | 2.50 | 1 | 3 | 0.52 | 1Score > 13 indicates identity |
INRIH |
| 3148 |
604.2864 | 1809.8374 | 1809.8535 | -8.94 | 1 | 3 | 1.9 | 1Score > 18 indicates identity |
MTGRLALVMGAEGEGMR + 2 Oxidation (M) |
| 2285 |
355.5231 | 1063.5475 | 1063.5549 | -7.03 | 0 | 3 | 2 | 1Score > 18 indicates identity |
VLEYNLAGGK + Deamidated (NQ) |
| 3464 |
721.0474 | 2160.1204 | 2160.1096 | 5.00 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
MSRVETIINELSLIASNPR + 2 Deamidated (NQ); Oxidation (M) |
| 2296 |
1074.5690 | 1073.5617 | 1073.5604 | 1.22 | 0 | 3 | 0.89 | 1Score > 20 indicates identity Score > 15 indicates homology |
DLNLALQSAK + 2 Deamidated (NQ) |
| 3180 |
610.6891 | 1829.0455 | 1829.0518 | -3.47 | 1 | 3 | 0.52 | 1Score > 13 indicates identity |
MDIKVMLGLDALILLR + Oxidation (M) |
| 3384 |
687.3525 | 2059.0357 | 2059.0408 | -2.48 | 0 | 3 | 0.69 | 1Score > 20 indicates identity Score > 14 indicates homology |
LEAMLPGYTAALATQPAEGR |
| 3717 |
837.4462 | 2509.3168 | 2509.3064 | 4.14 | 1 | 3 | 1.7 | 1Score > 18 indicates identity |
VKEFGPLIVSIDTHGNNLIAENK + 2 Deamidated (NQ) |
| 2103 |
482.7322 | 963.4498 | 963.4410 | 9.21 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
EAQAENFR |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/