MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1258_JBEI_Tube2_A2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:35:06 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,668

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 3989)


Page: Previous 1 2 3 4 5 6 7  40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2438 582.2924 1162.5702 1162.5870 -14.4 0 8 0.61 +1Score > 19 indicates identity NGVNVSFSIPK + 2 Deamidated (NQ)
1997 449.7626 897.5106 897.5144 -4.20 1 8 0.17 +1Score > 13 indicates identity LAGSPRAAR
3084 860.4208 1718.8270 1718.8151 6.93 1 8 0.8 +1Score > 20 indicates identity NYVVKLQSGDEYFR + 2 Deamidated (NQ)
1912 822.4178 821.4105 821.4031 8.99 0 8 0.34 +1Score > 16 indicates identity AFNSLNR + Deamidated (NQ)
1547 515.3312 514.3239 514.3227 2.34 0 8 0.71 +1Score > 22 indicates identity
Score > 19 indicates homology
LAGVR
2063 473.2743 944.5340 944.5291 5.27 0 8 0.65 +1Score > 19 indicates identity LALNVASTR + Deamidated (NQ)
1875 401.6959 801.3772 801.3803 -3.82 0 8 0.15 +1Score > 13 indicates identity MTHQLR + Deamidated (NQ); Oxidation (M)
2519 612.3494 1222.6842 1222.6809 2.77 1 8 0.25 +1Score > 15 indicates identity IEIYSKTLEK
3439 706.0266 2115.0580 2115.0882 -14.3 1 8 0.69 +1Score > 19 indicates identity MDSVPVIVLSGLTDEQKQR + Deamidated (NQ)
2777 731.3661 1460.7176 1460.7372 -13.4 1 8 0.51 +1Score > 20 indicates identity
Score > 18 indicates homology
WQSTSVNDVLRR + Deamidated (NQ)
2104 482.7326 963.4506 963.4661 -16.1 0 8 0.5 +1Score > 18 indicates identity FQEQVNAK + Deamidated (NQ)
2110 483.2619 964.5092 964.4978 11.9 1 8 0.63 +1Score > 19 indicates identity QQYREIK + Deamidated (NQ)
2015 457.7524 913.4902 913.4730 18.9 0 8 0.32 +1Score > 16 indicates identity GANQAVAAGR
3503 743.0306 2226.0700 2226.0335 16.4 0 8 0.74 +1Score > 19 indicates identity IIEQMEAQGIVSEQGHNGNR + Deamidated (NQ); Oxidation (M)
2240 517.7861 1033.5576 1033.5556 1.95 0 8 0.57 +1Score > 18 indicates identity LAQGEFLTR
2242 517.7878 1033.5610 1033.5556 5.24 0 8 0.61 +1Score > 18 indicates identity LAQGEFLTR
2306 364.8751 1091.6035 1091.5975 5.50 1 8 0.51 +1Score > 17 indicates identity DNVLRYIAK + Deamidated (NQ)
2441 389.1915 1164.5527 1164.5636 -9.34 1 8 0.7 +1Score > 19 indicates identity QEYTGARNAR
1755 697.4272 696.4199 696.4283 -12.0 0 8 0.17 +1Score > 13 indicates identity LPNVVR
2338 557.8119 1113.6092 1113.6142 -4.44 1 8 0.67 +1Score > 18 indicates identity NKSPVEATLR
3196 928.4531 1854.8916 1854.9264 -18.7 1 8 0.84 +1Score > 19 indicates identity TLAAFWYLKSAQQGNR + 2 Deamidated (NQ)
1752 346.2130 690.4114 690.4024 13.1 1 7 0.21 +1Score > 13 indicates identity TKSSLR
1839 382.1936 762.3726 762.3582 19.0 0 7 0.62 +1Score > 18 indicates identity LEQDMK
2239 515.7899 1029.5652 1029.5567 8.29 0 7 0.24 +1Score > 21 indicates identity
Score > 14 indicates homology
VGVTGNISQR
2352 560.8032 1119.5918 1119.6036 -10.5 0 7 0.7 +1Score > 18 indicates identity HPELLNEIR
2649 687.3591 1372.7036 1372.7198 -11.8 0 7 0.86 +1Score > 19 indicates identity SQAAADLLAVTDAK
2157 492.7866 983.5586 983.5763 -18.0 1 7 0.34 +1Score > 15 indicates identity LPKAEIASR
2291 535.2759 1068.5372 1068.5240 12.4 0 7 0.49 +1Score > 17 indicates identity VLADGQFYR + Deamidated (NQ)
4041 946.4783 2836.4131 2836.3742 13.7 0 7 1 +1Score > 20 indicates identity
Score > 20 indicates homology
NLTDYGAFVDLGGVDGLLHITDMAWK + Oxidation (M)
2007 455.2639 908.5132 908.4967 18.2 0 7 0.28 +1Score > 14 indicates identity IAVSYQTK
1696 664.3058 663.2985 663.3010 -3.73 0 7 0.38 +1Score > 16 indicates identity LCQSR + Deamidated (NQ)
2433 581.3307 1160.6468 1160.6475 -0.54 1 7 0.59 +1Score > 17 indicates identity GVQIMKEIVK + Deamidated (NQ); Oxidation (M)
2451 392.8722 1175.5948 1175.6160 -18.0 1 7 0.76 +1Score > 18 indicates identity LGRDGATPHPR
2221 508.7833 1015.5520 1015.5662 -13.9 0 7 0.94 +1Score > 19 indicates identity LESQIGTLR
1750 346.1761 690.3376 690.3483 -15.4 1 7 0.54 +1Score > 17 indicates identity KCNLR + Deamidated (NQ)
1695 332.6564 663.2982 663.3010 -4.16 0 7 0.39 +1Score > 16 indicates identity GDGLMR + Oxidation (M)
1979 437.7422 873.4698 873.4556 16.4 0 7 0.32 +1Score > 21 indicates identity
Score > 15 indicates homology
DIINAATR + Deamidated (NQ)
4408 979.9327 3915.7017 3915.7269 -6.42 1 7 0.25 +1Score > 13 indicates identity YDDGALTAEMGLFLINFNNQYDSNQTNDTVTARGK + 4 Deamidated (NQ); Oxidation (M)
3599 586.0222 2340.0597 2340.0943 -14.8 0 7 0.53 +1Score > 17 indicates identity YLNNINGLLTSFCGADAPQLR + 4 Deamidated (NQ)
2538 412.5488 1234.6246 1234.6305 -4.83 1 7 0.79 +1Score > 18 indicates identity IANYLERQAR + 2 Deamidated (NQ)
2503 404.2189 1209.6349 1209.6393 -3.68 0 7 0.47 +1Score > 16 indicates identity NYQAALFILR + 2 Deamidated (NQ)
3347 671.6951 2012.0635 2012.0261 18.6 1 7 0.66 +1Score > 18 indicates identity IRQMPGLNAIEHSNYLR + Deamidated (NQ)
1693 329.2245 656.4344 656.4333 1.72 1 7 0.23 +1Score > 13 indicates identity AVIKAR
1500 489.2788 488.2715 488.2707 1.74 0 7 0.86 +1Score > 20 indicates identity
Score > 19 indicates homology
TAAAR
4629 1028.9403 5139.6651 5139.6220 8.39 1 7 0.28 +1Score > 14 indicates identity GRLMQALPAGGAMVAVAASQHEVEPLLVEGVDIAALNAPGSVVISGDQAAVR + 3 Deamidated (NQ); 2 Oxidation (M)
2555 417.8829 1250.6269 1250.6367 -7.86 0 7 0.91 +1Score > 19 indicates identity ANQLAELAHQR + Deamidated (NQ)
1628 607.2846 606.2773 606.2795 -3.63 0 7 0.48 +1Score > 16 indicates identity NSVMR + Deamidated (NQ)
2379 568.7854 1135.5562 1135.5478 7.46 1 7 0.95 +1Score > 19 indicates identity MSKICNDLR
2194 500.7889 999.5632 999.5712 -8.00 1 7 0.81 +1Score > 18 indicates identity LALAKEEAR
2348 373.8716 1118.5930 1118.6044 -10.2 1 7 0.94 +1Score > 19 indicates identity QTGRTLTSAGK
2717 713.3825 1424.7504 1424.7459 3.20 1 7 0.57 +1Score > 17 indicates identity WRHQAIQALMR + Oxidation (M)
2077 475.2350 948.4554 948.4665 -11.6 0 7 0.79 +1Score > 18 indicates identity AEIDAGFAR
2092 480.2774 958.5402 958.5487 -8.86 0 7 0.83 +1Score > 18 indicates identity IAQAPAFLK + Deamidated (NQ)
2714 475.9207 1424.7403 1424.7234 11.8 1 7 0.67 +1Score > 17 indicates identity VEIAPFAYMRGR + Oxidation (M)
3643 797.4296 2389.2670 2389.2740 -2.96 1 7 0.56 +1Score > 17 indicates identity SSLPLGKFLVTEGVISQETLDR + Deamidated (NQ)
1973 437.2122 872.4098 872.4141 -4.83 0 7 0.33 +1Score > 14 indicates identity WPGETQR
3471 724.7259 2171.1559 2171.1222 15.5 1 7 0.57 +1Score > 17 indicates identity LEGWSESGAQAKIAIAEGQVK
1754 697.4257 696.4184 696.4283 -14.1 0 7 0.22 +1Score > 13 indicates identity LPNVVR
2158 492.7906 983.5666 983.5763 -9.85 1 6 0.31 +1Score > 14 indicates identity ALAIAAREVA
3356 674.6743 2021.0011 2020.9623 19.2 1 6 0.34 +1Score > 20 indicates identity
Score > 14 indicates homology
AITGEEMTQEKLDLAAER + Deamidated (NQ); Oxidation (M)
3866 674.8702 2695.4517 2695.4190 12.1 1 6 0.48 +1Score > 16 indicates identity VFPESIVRTVVHMMESVALPGGGGVK
1817 372.7235 743.4324 743.4289 4.72 1 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology
ALARNAK + Deamidated (NQ)
3601 586.0239 2340.0665 2340.0725 -2.58 1 6 0.71 +1Score > 17 indicates identity QAESMLESMASRIDNYPELR + Deamidated (NQ)
1814 372.7218 743.4290 743.4289 0.15 1 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology
ALARNAK + Deamidated (NQ)
2268 350.8471 1049.5195 1049.5288 -8.88 1 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology
RMTGVTVDR + Oxidation (M)
2399 572.3576 1142.7006 1142.6910 8.41 1 6 0.23 +1Score > 13 indicates identity KQTALVELLK + Deamidated (NQ)
2202 501.7920 1001.5694 1001.5692 0.28 1 6 0.96 +1Score > 19 indicates identity LAPVMAKTR + Oxidation (M)
2203 501.7929 1001.5712 1001.5869 -15.7 0 6 0.53 +1Score > 16 indicates identity SVGTSLLVAR
2145 491.2508 980.4870 980.5039 -17.2 1 6 0.77 +1Score > 18 indicates identity QQRYSATK
3946 911.8293 2732.4661 2732.4968 -11.3 1 6 0.51 +1Score > 16 indicates identity ALAAIGLAAVMSQSAMAENLKLGFLVK + Oxidation (M)
2529 614.8386 1227.6626 1227.6571 4.52 1 6 1 +1Score > 19 indicates identity QRLDAINQLR + 2 Deamidated (NQ)
2122 485.2862 968.5578 968.5403 18.1 1 6 0.31 +1Score > 14 indicates identity ARLQPQQK + Deamidated (NQ)
2257 521.7994 1041.5842 1041.5679 15.7 1 6 0.77 +1Score > 17 indicates identity LQQVAGRDR
2006 455.2630 908.5114 908.4967 16.2 0 6 0.32 +1Score > 14 indicates identity IAVSYQTK
3465 721.3785 2161.1137 2161.0956 8.35 1 6 0.92 +1Score > 18 indicates identity SHWATFKQTATNLWVTLR + 2 Deamidated (NQ)
2193 500.7881 999.5616 999.5713 -9.66 0 6 0.8 +1Score > 18 indicates identity LGGGTVLQQK
3325 663.3549 1987.0429 1987.0626 -9.92 1 6 1.1 +1Score > 19 indicates identity ELLTTLNLKLEPADDFR
2422 578.3246 1154.6346 1154.6481 -11.7 0 6 0.56 +1Score > 16 indicates identity IGAIMVPINAR + Deamidated (NQ)
1501 489.2795 488.2722 488.2707 3.17 0 6 0.85 +1Score > 21 indicates identity
Score > 18 indicates homology
TAAAR
2778 731.3685 1460.7224 1460.7372 -10.1 1 6 0.3 +1Score > 20 indicates identity
Score > 13 indicates homology
WQSTSVNDVLRR + Deamidated (NQ)
3057 418.9310 1671.6949 1671.7246 -17.8 1 6 0.26 +1Score > 13 indicates identity MNFSHGSPEDHKMR
3382 1030.5236 2059.0326 2059.0011 15.3 0 6 0.51 +1Score > 20 indicates identity
Score > 15 indicates homology
NWLTADGAPGPTGTGGFIAEK
3120 592.9709 1775.8909 1775.9240 -18.7 1 6 1.2 +1Score > 19 indicates identity FVVMPGRDTVVDVQSK
2760 723.8889 1445.7632 1445.7548 5.87 0 6 0.91 +1Score > 18 indicates identity MAIAEAITNIAATR + Deamidated (NQ)
1868 400.7366 799.4586 799.4552 4.35 0 6 0.93 +1Score > 18 indicates identity LAQAAGIR + Deamidated (NQ)
2452 392.8724 1175.5954 1175.6160 -17.5 1 6 1.1 +1Score > 19 indicates identity LGRDGATPHPR
3355 674.3680 2020.0822 2020.0953 -6.49 0 6 0.62 +1Score > 16 indicates identity LISVHNADLNVVLTTPASR + Deamidated (NQ)
2500 605.8064 1209.5982 1209.5850 10.9 0 6 0.87 +1Score > 17 indicates identity QQHSDVRPSR + Deamidated (NQ)
4403 971.4843 3881.9081 3881.8366 18.4 0 6 0.92 +1Score > 18 indicates identity LHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVK + Deamidated (NQ)
1644 309.1685 616.3224 616.3180 7.20 0 6 1 +1Score > 21 indicates identity
Score > 18 indicates homology
EEAIR
2036 465.7283 929.4420 929.4566 -15.7 0 5 0.41 +1Score > 14 indicates identity VDVAENQR
3200 931.4991 1860.9836 1860.9945 -5.82 1 5 1.3 +1Score > 19 indicates identity INITLQKEEGGLYNLR + Deamidated (NQ)
1598 574.3217 573.3144 573.3122 3.89 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
AENIK
3425 525.2538 2096.9861 2096.9911 -2.39 0 5 0.32 +1Score > 20 indicates identity
Score > 13 indicates homology
VIPGFMIQGGGFTEQMQQK + 2 Deamidated (NQ)
1577 559.3254 558.3181 558.3125 9.99 0 5 0.57 +1Score > 22 indicates identity
Score > 15 indicates homology
AVNVR + Deamidated (NQ)
1987 890.4249 889.4176 889.4042 15.1 0 5 1.1 +1Score > 18 indicates identity FGGNPENR
2686 703.3741 1404.7336 1404.7547 -15.0 1 5 1.3 +1Score > 19 indicates identity WNAIMTVLRASK + Oxidation (M)
3427 525.7665 2099.0369 2099.0647 -13.2 1 5 1.3 +1Score > 19 indicates identity AIPNQGVQKQIDLFGNAER + 2 Deamidated (NQ)
3754 850.7610 2549.2612 2549.2835 -8.77 1 5 0.72 +1Score > 20 indicates identity
Score > 16 indicates homology
GLMNVQFAVKNNEVYLIEVNPR + 3 Deamidated (NQ)
2527 410.2266 1227.6580 1227.6571 0.71 1 5 1.4 +1Score > 19 indicates identity QRLDAINQLR + 2 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7  40 Next 

Not what you expected? Try the select summary.