MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1258_JBEI_Tube2_A2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:35:06 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,668

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 63)


Page: 1 2 3 4 5 6  7 Next 

+1

Accession Score Description
1 RHAA_ECOLI 6577 L-rhamnose isomerase OS=Escherichia coli (strain K12) GN=rhaA PE=1 SV=2

-2

Accession Score Description
1 PEPB_ECOLI 1618 Peptidase B OS=Escherichia coli (strain K12) GN=pepB PE=3 SV=2
Score Mass Matches Sequences emPAI
2.1 PEPB_ECOLI 1618 46436 55 (50) 25 (23) 9.34
Peptidase B OS=Escherichia coli (strain K12) GN=pepB PE=3 SV=2

-55 peptide matches (38 non-duplicate, 17 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
1776   358.2230 714.4314 714.4276 5.41 0 10 0.39 +1Score > 18 indicates identity U K.IDGLGIK.H
1899 +1 816.4905 815.4832 815.4752 9.78 0 32 0.0023 +1Score > 18 indicates identity U R.TIANLLTA.-
1900 +1 408.7491 815.4836 815.4752 10.3 0 26 0.0086 +1Score > 18 indicates identity U R.TIANLLTA.-
1940 +1 422.2711 842.5276 842.5225 6.07 1 38 0.00024 +1Score > 14 indicates identity U R.KIDGLGIK.H
2082 +1 475.7705 949.5264 949.5233 3.35 0 60 1.6e-006 +1Score > 15 indicates identity U K.LGDIITYR.N
2154 +2 328.1878 981.5416 981.5396 2.03 0 44 6e-005 +1Score > 14 indicates identity U R.LPLAEFHR.S
2156 +1 491.7790 981.5434 981.5396 3.94 0 18 0.021 +1Score > 14 indicates identity U R.LPLAEFHR.S
2283 +1 531.2990 1060.5834 1060.5739 8.98 0 41 0.00027 +1Score > 17 indicates identity U R.LMIIDWVR.D + Oxidation (M)
2304   545.7320 1089.4494 1089.4471 2.17 0 18 0.017 +1Score > 13 indicates identity U K.QTAFMDSMK.S + 2 Oxidation (M)
2447 +1 586.8203 1171.6260 1171.6197 5.43 0 65 1.3e-006 +1Score > 19 indicates identity U K.ITLSTQPADAR.W
2531 +1 615.3311 1228.6476 1228.6412 5.28 0 67 9.3e-007 +1Score > 19 indicates identity U R.AVDLISNVAGDR.V
2542   618.7816 1235.5486 1235.5452 2.78 0 57 4.4e-006 +1Score > 16 indicates identity U K.VEVMNTDAEGR.L + Oxidation (M)
2547 +1 622.8118 1243.6090 1243.6085 0.46 0 67 6.3e-007 +1Score > 17 indicates identity U K.GITFDSGGYSIK.Q
2554   417.5641 1249.6705 1249.6666 3.08 1 9 0.42 +1Score > 18 indicates identity U K.LGDIITYRNGK.K + Deamidated (NQ)
2642   455.2192 1362.6358 1362.6350 0.54 0 20 0.027 +1Score > 17 indicates identity U R.EQGYMGLHTVGR.G + Oxidation (M)
2644   682.8298 1363.6450 1363.6402 3.58 1 26 0.011 +1Score > 19 indicates identity U K.KVEVMNTDAEGR.L + Oxidation (M)
2645 +1 455.5558 1363.6456 1363.6402 3.96 1 40 0.00046 +1Score > 19 indicates identity U K.KVEVMNTDAEGR.L + Oxidation (M)
2919   801.9263 1601.8380 1601.8301 4.98 0 52 3e-005 +1Score > 19 indicates identity U R.SPVLLALDYNPTGDK.E
2998   816.4141 1630.8136 1630.8103 2.04 0 96 1.1e-009 +1Score > 19 indicates identity U R.LLASAAQENEPFWR.L
2999   544.6119 1630.8139 1630.8103 2.18 0 58 6.8e-006 +1Score > 19 indicates identity U R.LLASAAQENEPFWR.L
3001   816.9191 1631.8236 1631.7943 18.0 0 35 0.0017 +1Score > 19 indicates identity U R.LLASAAQENEPFWR.L + Deamidated (NQ)
3102   874.9733 1747.9320 1747.9217 5.92 1 20 0.028 +1Score > 17 indicates identity U R.AVDLISNVAGDRVTYR.I
3103 +1 583.6513 1747.9321 1747.9217 5.94 1 54 1.2e-005 +1Score > 17 indicates identity U R.AVDLISNVAGDRVTYR.I
3159   913.4599 1824.9052 1824.9040 0.68 0 49 5.7e-005 +1Score > 19 indicates identity U K.SDMGGAATVTGALAFAITR.G + Oxidation (M)
3248   955.4888 1908.9630 1908.9541 4.69 0 59 6.2e-006 +1Score > 19 indicates identity U R.DTINAPAEELGPSQLAQR.A
3249   637.6608 1909.9606 1909.9381 11.8 0 73 1.9e-007 +1Score > 18 indicates identity U R.DTINAPAEELGPSQLAQR.A + Deamidated (NQ)
3250   955.9880 1909.9614 1909.9381 12.2 0 57 8e-006 +1Score > 18 indicates identity U R.DTINAPAEELGPSQLAQR.A + Deamidated (NQ)
3251   637.6624 1909.9654 1909.9381 14.3 0 67 6.9e-007 +1Score > 18 indicates identity U R.DTINAPAEELGPSQLAQR.A + Deamidated (NQ)
3267 +1 484.2368 1932.9181 1932.9112 3.56 1 14 0.2 +1Score > 19 indicates identity U K.GEDLREQGYMGLHTVGR.G + Oxidation (M)
3268   645.3146 1932.9220 1932.9112 5.57 1 27 0.0098 +1Score > 19 indicates identity U K.GEDLREQGYMGLHTVGR.G + Oxidation (M)
3459   1078.0176 2154.0206 2154.0018 8.76 0 113 1.9e-011 +1Score > 19 indicates identity U K.TALGNDYHALFSFDDALAGR.L + Deamidated (NQ)
3460 +1 719.0146 2154.0220 2154.0018 9.37 0 104 1.9e-010 +1Score > 19 indicates identity U K.TALGNDYHALFSFDDALAGR.L + Deamidated (NQ)
3844   895.7980 2684.3722 2684.3405 11.8 0 64 1.5e-006 +1Score > 18 indicates identity U K.ATYSINNDGITLHLNGADDLGLIQR.A + Deamidated (NQ)
3845   896.1242 2685.3508 2685.3246 9.76 0 50 5.1e-005 +1Score > 19 indicates identity U K.ATYSINNDGITLHLNGADDLGLIQR.A + 2 Deamidated (NQ)
4018   931.1534 2790.4384 2790.4150 8.39 1 54 1.3e-005 +1Score > 18 indicates identity U R.SPVLLALDYNPTGDKEAPVYACLVGK.G + Deamidated (NQ)
4080 +1 971.8641 2912.5705 2912.5416 9.91 0 74 5.6e-008 +1Score > 14 indicates identity U R.LVLADGLIDASAQKPEMIIDAATLTGAAK.T + Deamidated (NQ); Oxidation (M)
D:\Xcalibur\Data\Jennifer\PRT1258 ThomasE\PRT1258_JBEI_Tube2_A2.raw

Score > 14 indicates identity

4082 +1 729.1509 2912.5745 2912.5416 11.3 0 58 2.7e-006 -1Score > 14 indicates identity U R.LVLADGLIDASAQKPEMIIDAATLTGAAK.T + Deamidated (NQ); Oxidation (M)
1.04 0 7 0.32 2 MMIATLAAASVLLAVANQAVAGATLDAVQK   + Deamidated (NQ)
1.04 0 7 0.32 2 MMIATLAAASVLLAVANQAVAGATLDAVQK   + Deamidated (NQ)
17.4 0 5 0.48 4 MMIATLAAASVLLAVANQAPAGATLDAVQK   + 3 Deamidated (NQ)
1.04 0 5 0.48 4 MMIATLAAASVLLAVANQAVAGATLDAVQK   + Deamidated (NQ)
4098   985.1878 2952.5416 2952.5015 13.6 1 42 0.0002 +1Score > 18 indicates identity U R.LMIIDWVRDTINAPAEELGPSQLAQR.A + Deamidated (NQ); Oxidation (M)

+3

Accession Score Description
1 IADA_ECOLI 651 Isoaspartyl dipeptidase OS=Escherichia coli (strain K12) GN=iadA PE=1 SV=1

+4

Accession Score Description
1 CODA_ECOLI 463 Cytosine deaminase OS=Escherichia coli (strain K12) GN=codA PE=1 SV=3

+5

Accession Score Description
1 ALF1_ECOLI 333 Fructose-bisphosphate aldolase class 1 OS=Escherichia coli (strain K12) GN=fbaB PE=1 SV=2

+6

Accession Score Description
1 CATNterm_ECOLX 324 Chloramphenicol acetyltransferase with N-terminal tag OS=Escherichia coli GN=cat PE=1 SV=1

+7

Accession Score Description
1 YGEY_ECOLI 280 Uncharacterized protein YgeY OS=Escherichia coli (strain K12) GN=ygeY PE=3 SV=1

+8

Accession Score Description
1 KDSC_ECOLI 270 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC OS=Escherichia coli (strain K12) GN=kdsC PE=1 SV=1

+9

Accession Score Description
1 TRYP_PIG 263 Trypsin OS=Sus scrofa PE=1 SV=1

+10

Accession Score Description
1 GLDA_ECOLI 261 Glycerol dehydrogenase OS=Escherichia coli (strain K12) GN=gldA PE=1 SV=1
Page: 1 2 3 4 5 6  7 Next 

Not what you expected? Try the select summary.