MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1258_JBEI_Tube2_A2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:35:06 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,668

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 63)


Page: 1 2 3 4 5 6  7 Next 

-1

Accession Score Description
1 RHAA_ECOLI 6577 L-rhamnose isomerase OS=Escherichia coli (strain K12) GN=rhaA PE=1 SV=2
Score Mass Matches Sequences emPAI
1.1 RHAA_ECOLI 6577 47455 276 (235) 46 (43) 587.65
L-rhamnose isomerase OS=Escherichia coli (strain K12) GN=rhaA PE=1 SV=2

-276 peptide matches (117 non-duplicate, 159 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
1617 +2 300.7141 599.4136 599.4118 3.00 1 23 0.0068 +1Score > 13 indicates identity U K.KALLR.A
1649 +1 624.4094 623.4021 623.4006 2.39 0 36 0.00024 +1Score > 13 indicates identity U R.LIPGPK.R
1652 +4 312.7094 623.4042 623.4006 5.80 0 25 0.0031 +1Score > 13 indicates identity U R.LIPGPK.R
1743 +2 689.3596 688.3523 688.3504 2.84 0 38 0.00081 +1Score > 20 indicates identity U R.NASELR.A
1744 +2 345.1836 688.3526 688.3504 3.31 0 41 0.00042 +1Score > 20 indicates identity U R.NASELR.A
1747   690.3405 689.3332 689.3344 -1.68 0 9 0.62 +1Score > 19 indicates identity U R.NASELR.A + Deamidated (NQ)
1749 +1 345.6757 689.3368 689.3344 3.58 0 49 7.6e-005 +1Score > 20 indicates identity U R.NASELR.A + Deamidated (NQ)
1781 +1 718.3736 717.3663 717.3657 0.84 0 35 0.001 +1Score > 18 indicates identity U K.DITVDR.L
1782 +1 359.6916 717.3686 717.3657 4.08 0 31 0.003 +1Score > 19 indicates identity U K.DITVDR.L
1851 +1 390.7596 779.5046 779.5017 3.73 1 18 0.015 +1Score > 13 indicates identity U R.LIPGPKR.L
1874 +8 401.6955 801.3764 801.3770 -0.63 0 39 0.00014 +1Score > 13 indicates identity U R.HDLFDR.V
1884 +1 802.3890 801.3817 801.3770 5.95 0 28 0.0016 +1Score > 13 indicates identity U R.HDLFDR.V
2021   459.2443 916.4740 916.4726 1.59 1 19 0.069 +1Score > 20 indicates identity U K.ARNASELR.A + Deamidated (NQ)
2041 +2 466.7354 931.4562 931.4552 1.14 0 29 0.0056 +1Score > 19 indicates identity U K.NWVEWAK.A
2043 +1 932.4648 931.4575 931.4552 2.51 0 38 0.00065 +1Score > 19 indicates identity U K.NWVEWAK.A
2046   467.2260 932.4374 932.4392 -1.87 0 33 0.0016 +1Score > 17 indicates identity U K.NWVEWAK.A + Deamidated (NQ)
2047   467.2301 932.4456 932.4385 7.63 0 38 0.00054 +1Score > 18 indicates identity U R.ADLEQAMR.L
2051 +7 472.2758 942.5370 942.5386 -1.60 0 48 5.5e-005 +1Score > 18 indicates identity U R.LALLEEQK.S
2054 +2 943.5476 942.5403 942.5386 1.87 0 53 1.7e-005 +1Score > 18 indicates identity U R.LALLEEQK.S
2072 +2 475.2226 948.4306 948.4335 -2.96 0 44 7.6e-005 +1Score > 16 indicates identity U R.ADLEQAMR.L + Oxidation (M)
2074 +1 949.4435 948.4362 948.4335 2.92 0 15 0.063 +1Score > 16 indicates identity U R.ADLEQAMR.L + Oxidation (M)
2160 +5 493.7917 985.5688 985.5709 -2.07 0 53 1.5e-005 +1Score > 17 indicates identity U R.IAAWVIGTR.N
2161 +1 986.5787 985.5714 985.5709 0.54 0 46 7.7e-005 +1Score > 17 indicates identity U R.IAAWVIGTR.N
2288   1066.5181 1065.5108 1065.5091 1.65 0 23 0.018 +1Score > 18 indicates identity U K.LEAAGDYTAR.L
2289 +1 533.7639 1065.5132 1065.5091 3.93 0 67 7.5e-007 +1Score > 18 indicates identity U K.LEAAGDYTAR.L
2376 +1 567.2657 1132.5168 1132.5124 3.92 0 46 7.1e-005 +1Score > 17 indicates identity U R.QFWIDHCK.A
2377 +1 378.5132 1132.5178 1132.5124 4.74 0 27 0.0056 +1Score > 17 indicates identity U R.QFWIDHCK.A
2389 +4 381.2046 1140.5920 1140.5927 -0.68 0 41 0.00023 +1Score > 17 indicates identity U R.DQIKPEHFK.N
2395 +1 571.3065 1140.5984 1140.5927 5.00 0 40 0.00024 +1Score > 17 indicates identity U R.DQIKPEHFK.N
2473 +3 597.8096 1193.6046 1193.6040 0.53 1 78 5.7e-008 +1Score > 18 indicates identity U R.KLEAAGDYTAR.L
2474   1194.6129 1193.6056 1193.6040 1.34 1 58 5.9e-006 +1Score > 18 indicates identity U R.KLEAAGDYTAR.L
2477 +3 398.8766 1193.6080 1193.6040 3.31 1 61 3e-006 +1Score > 18 indicates identity U R.KLEAAGDYTAR.L
2598   434.2512 1299.7318 1299.7285 2.48 0 44 7.9e-005 +1Score > 16 indicates identity U R.LLAALDEVISEK.L
2600 +3 650.8746 1299.7346 1299.7285 4.69 0 75 6.5e-008 +1Score > 16 indicates identity U R.LLAALDEVISEK.L
2662 +2 463.9183 1388.7331 1388.7300 2.24 0 66 1.2e-006 +1Score > 19 indicates identity U R.FAAVGIDVEEALR.Q
2672 +15 695.3785 1388.7424 1388.7300 8.99 0 101 2.9e-010 +1Score > 18 indicates identity U R.FAAVGIDVEEALR.Q
2703 +2 709.3699 1416.7252 1416.7249 0.27 0 64 1.8e-006 +1Score > 19 indicates identity U M.TTQLEQAWELAK.Q
2706   709.8685 1417.7224 1417.7089 9.57 0 68 5.8e-007 +1Score > 18 indicates identity U M.TTQLEQAWELAK.Q + Deamidated (NQ)
2732 +1 716.3673 1430.7200 1430.7154 3.27 0 49 6e-005 +1Score > 20 indicates identity U K.LNPAHHIDAVESK.L + Deamidated (NQ)
2734 +2 358.6880 1430.7229 1430.7154 5.27 0 33 0.0026 +1Score > 19 indicates identity U K.LNPAHHIDAVESK.L + Deamidated (NQ)
2737 +2 477.9154 1430.7244 1430.7154 6.30 0 39 0.00062 +1Score > 20 indicates identity U K.LNPAHHIDAVESK.L + Deamidated (NQ)
2852   774.8960 1547.7774 1547.7653 7.82 0 33 0.0029 +1Score > 20 indicates identity U -.MTTQLEQAWELAK.Q
2858 +1 782.8876 1563.7606 1563.7603 0.24 0 103 2.3e-010 +1Score > 19 indicates identity U -.MTTQLEQAWELAK.Q + Oxidation (M)
2859   522.2610 1563.7612 1563.7603 0.58 0 31 0.0032 +1Score > 19 indicates identity U -.MTTQLEQAWELAK.Q + Oxidation (M)
2861   783.3853 1564.7560 1564.7443 7.52 0 85 1.2e-008 +1Score > 19 indicates identity U -.MTTQLEQAWELAK.Q + Deamidated (NQ); Oxidation (M)
2862   522.5967 1564.7683 1564.7443 15.3 0 16 0.12 +1Score > 19 indicates identity U -.MTTQLEQAWELAK.Q + Deamidated (NQ); Oxidation (M)
2863   783.3937 1564.7728 1564.7443 18.3 0 59 5.9e-006 +1Score > 19 indicates identity U -.MTTQLEQAWELAK.Q + Deamidated (NQ); Oxidation (M)
2877 +2 528.5870 1582.7392 1582.7376 1.01 0 60 2.4e-006 +1Score > 16 indicates identity U R.HDTPAGSEWLESVR.A
2878 +1 792.3775 1582.7404 1582.7376 1.81 0 93 1.1e-009 +1Score > 16 indicates identity U R.HDTPAGSEWLESVR.A
2922 +3 802.4154 1602.8162 1602.8154 0.50 0 67 1e-006 +1Score > 20 indicates identity U R.VHIGLDFFDASINR.I
2926 +11 535.2819 1602.8239 1602.8154 5.26 0 85 1.6e-008 +1Score > 19 indicates identity U R.VHIGLDFFDASINR.I
2936 +1 802.9196 1603.8246 1603.7995 15.7 0 32 0.0031 +1Score > 20 indicates identity U R.VHIGLDFFDASINR.I + Deamidated (NQ)
2962 +1 810.3955 1618.7764 1618.7733 1.96 1 63 1.8e-006 +1Score > 18 indicates identity U R.NASELRADLEQAMR.L + Oxidation (M)
2964 +2 540.6008 1618.7806 1618.7733 4.51 1 30 0.0041 +1Score > 18 indicates identity U R.NASELRADLEQAMR.L + Oxidation (M)
2976 +1 810.8906 1619.7666 1619.7573 5.78 1 14 0.14 +1Score > 18 indicates identity U R.NASELRADLEQAMR.L + Deamidated (NQ); Oxidation (M)
2977 +1 540.9321 1619.7745 1619.7573 10.6 1 16 0.096 +1Score > 18 indicates identity U R.NASELRADLEQAMR.L + Deamidated (NQ); Oxidation (M)
3064 +1 558.6447 1672.9123 1672.8896 13.5 1 41 0.00022 +1Score > 17 indicates identity U K.QRFAAVGIDVEEALR.Q
3080   567.9727 1700.8963 1700.8846 6.89 1 9 0.56 +1Score > 19 indicates identity U M.TTQLEQAWELAKQR.F
3167 +2 609.9918 1826.9536 1826.9526 0.51 0 68 5.4e-007 +1Score > 18 indicates identity U R.LNLHAIYLESDTPVSR.D
3168   914.4841 1826.9536 1826.9526 0.55 0 68 5.6e-007 +1Score > 18 indicates identity U R.LNLHAIYLESDTPVSR.D
3172   610.3255 1827.9547 1827.9366 9.86 0 39 0.0005 +1Score > 18 indicates identity U R.LNLHAIYLESDTPVSR.D + Deamidated (NQ)
3173   914.9883 1827.9620 1827.9366 13.9 0 63 1.7e-006 +1Score > 18 indicates identity U R.LNLHAIYLESDTPVSR.D + Deamidated (NQ)
3188   616.9855 1847.9347 1847.9200 7.97 1 76 1.4e-007 +1Score > 20 indicates identity U -.MTTQLEQAWELAKQR.F + Oxidation (M)
3214   623.9519 1868.8339 1868.8338 0.038 0 11 0.16 +1Score > 15 indicates identity U K.SLPWQAVWEMYCQR.H + Oxidation (M)
3215   935.4280 1868.8414 1868.8338 4.09 0 67 3.2e-007 +1Score > 15 indicates identity U K.SLPWQAVWEMYCQR.H + Oxidation (M)
3216   935.9282 1869.8418 1869.8178 12.9 0 26 0.0054 +1Score > 16 indicates identity U K.SLPWQAVWEMYCQR.H + Deamidated (NQ); Oxidation (M)
3217   624.2888 1869.8446 1869.8178 14.3 0 33 0.0013 +1Score > 16 indicates identity U K.SLPWQAVWEMYCQR.H + Deamidated (NQ); Oxidation (M)
3242   635.0107 1902.0103 1901.9847 13.5 1 24 0.015 +1Score > 18 indicates identity U R.FAAVGIDVEEALRQLDR.L + Deamidated (NQ)
3305   662.0254 1983.0544 1983.0537 0.32 1 47 6e-005 +1Score > 17 indicates identity U K.RLNLHAIYLESDTPVSR.D
3306   992.5360 1983.0574 1983.0537 1.87 1 80 3.2e-008 +1Score > 17 indicates identity U K.RLNLHAIYLESDTPVSR.D
3307 +1 496.7723 1983.0601 1983.0537 3.20 1 55 1.1e-005 +1Score > 17 indicates identity U K.RLNLHAIYLESDTPVSR.D
3313 +5 497.0225 1984.0609 1984.0378 11.7 1 43 0.00015 +1Score > 18 indicates identity U K.RLNLHAIYLESDTPVSR.D + Deamidated (NQ)
3314   993.0387 1984.0628 1984.0378 12.6 1 54 1.4e-005 +1Score > 17 indicates identity U K.RLNLHAIYLESDTPVSR.D + Deamidated (NQ)
3319 +5 662.3644 1984.0714 1984.0378 16.9 1 50 2.3e-005 +1Score > 17 indicates identity U K.RLNLHAIYLESDTPVSR.D + Deamidated (NQ)
3380 +1 514.7670 2055.0389 2055.0214 8.52 1 16 0.12 +1Score > 19 indicates identity U R.DQIKPEHFKNWVEWAK.A + Deamidated (NQ)
3513   560.5289 2238.0865 2238.0739 5.62 0 36 0.0013 +1Score > 19 indicates identity U R.QTALCLDAGHFHPTEVISDK.I
D:\Xcalibur\Data\Jennifer\PRT1258 ThomasE\PRT1258_JBEI_Tube2_A2.raw

Score > 19 indicates identity

3515   560.7772 2239.0797 2239.0579 9.72 0 41 0.00032 -1Score > 19 indicates identity U R.QTALCLDAGHFHPTEVISDK.I + Deamidated (NQ)
No other peptide matches in query
3516 +1 747.3716 2239.0930 2239.0579 15.6 0 32 0.0029 +1Score > 19 indicates identity U R.QTALCLDAGHFHPTEVISDK.I + Deamidated (NQ)
3525   566.8387 2263.3257 2263.2874 16.9 0 22 0.0067 +1Score > 13 indicates identity U K.ISAAMLYVPQLLLHVSRPVR.W + Deamidated (NQ)
3539 +3 570.8344 2279.3085 2279.2824 11.5 0 41 7.5e-005 +1Score > 13 indicates identity U K.ISAAMLYVPQLLLHVSRPVR.W + Deamidated (NQ); Oxidation (M)
3540 +1 760.7771 2279.3095 2279.2824 11.9 0 28 0.0016 +1Score > 13 indicates identity U K.ISAAMLYVPQLLLHVSRPVR.W + Deamidated (NQ); Oxidation (M)
3622   796.4059 2386.1959 2386.1818 5.88 1 31 0.0038 +1Score > 19 indicates identity U R.HDLFDRVHIGLDFFDASINR.I
3623   597.5598 2386.2101 2386.1818 11.8 1 44 0.0002 +1Score > 19 indicates identity U R.HDLFDRVHIGLDFFDASINR.I
3628 +5 478.4476 2387.2016 2387.1658 15.0 1 32 0.0028 +1Score > 19 indicates identity U R.HDLFDRVHIGLDFFDASINR.I + Deamidated (NQ)
3631 +6 597.8081 2387.2033 2387.1658 15.7 1 36 0.0012 +1Score > 19 indicates identity U R.HDLFDRVHIGLDFFDASINR.I + Deamidated (NQ)
3640 +4 796.7431 2387.2075 2387.1658 17.4 1 37 0.0011 +1Score > 19 indicates identity U R.HDLFDRVHIGLDFFDASINR.I + Deamidated (NQ)
3718   837.7523 2510.2351 2510.2289 2.46 0 9 0.63 +1Score > 19 indicates identity U R.WDSDHVVLLDDETQAIASEIVR.H
3719 +5 838.0853 2511.2341 2511.2129 8.43 0 56 6.2e-006 +1Score > 20 indicates identity
Score > 16 indicates homology
U R.WDSDHVVLLDDETQAIASEIVR.H + Deamidated (NQ)
3723   628.8187 2511.2457 2511.2129 13.1 0 42 0.00013 +1Score > 21 indicates identity
Score > 15 indicates homology
U R.WDSDHVVLLDDETQAIASEIVR.H + Deamidated (NQ)
3800   879.4091 2635.2055 2635.1901 5.85 0 12 0.22 +1Score > 18 indicates identity U K.LFGIGAESYTVGSNEFYMGYATSR.Q + Oxidation (M)
3803 +2 879.7396 2636.1970 2636.1741 8.69 0 68 5.2e-007 +1Score > 18 indicates identity U K.LFGIGAESYTVGSNEFYMGYATSR.Q + Deamidated (NQ); Oxidation (M)
3833   891.4344 2671.2814 2671.2662 5.67 0 53 2.5e-005 +1Score > 20 indicates identity U R.VSAYFGEQLGTPSVMNIWIPDGMK.D + 2 Oxidation (M)
3881   679.1140 2712.4269 2712.4333 -2.38 1 42 0.00016 +1Score > 17 indicates identity U R.LLAALDEVISEKLNPAHHIDAVESK.L + Deamidated (NQ)
4023   933.1262 2796.3568 2796.3615 -1.69 1 2 3.2 +3Score > 19 indicates identity U R.RVSAYFGEQLGTPSVMNIWIPDGMK.D + Deamidated (NQ)
4040   943.8023 2828.3851 2828.3513 11.9 1 39 0.00053 +1Score > 19 indicates identity U R.RVSAYFGEQLGTPSVMNIWIPDGMK.D + Deamidated (NQ); 2 Oxidation (M)
4095   591.1160 2950.5436 2950.5188 8.40 1 20 0.022 +1Score > 16 indicates identity U R.LNLHAIYLESDTPVSRDQIKPEHFK.N + Deamidated (NQ)
4186 +1 659.9314 3294.6206 3294.5793 12.5 1 19 0.046 +1Score > 19 indicates identity U R.WDSDHVVLLDDETQAIASEIVRHDLFDR.V + Deamidated (NQ)
4188   824.6639 3294.6265 3294.5793 14.3 1 29 0.0054 +1Score > 19 indicates identity U R.WDSDHVVLLDDETQAIASEIVRHDLFDR.V + Deamidated (NQ)
4209   1119.8929 3356.6569 3356.5945 18.6 1 18 0.079 +1Score > 19 indicates identity U R.VSAYFGEQLGTPSVMNIWIPDGMKDITVDR.L + 2 Deamidated (NQ); Oxidation (M)
4210   1124.8838 3371.6296 3371.6054 7.17 1 37 0.00097 +1Score > 20 indicates identity U R.VSAYFGEQLGTPSVMNIWIPDGMKDITVDR.L + Deamidated (NQ); 2 Oxidation (M)
4211   843.9150 3371.6309 3371.6054 7.56 1 40 0.00055 +1Score > 20 indicates identity U R.VSAYFGEQLGTPSVMNIWIPDGMKDITVDR.L + Deamidated (NQ); 2 Oxidation (M)
4212   843.9156 3371.6333 3371.6054 8.28 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
U R.VSAYFGEQLGTPSVMNIWIPDGMKDITVDR.L + Deamidated (NQ); 2 Oxidation (M)
4213   1125.2179 3372.6319 3372.5894 12.6 1 37 0.0011 +1Score > 20 indicates identity U R.VSAYFGEQLGTPSVMNIWIPDGMKDITVDR.L + 2 Deamidated (NQ); 2 Oxidation (M)
4387 +1 956.6918 3822.7381 3822.6778 15.8 0 45 7.6e-005 +1Score > 17 indicates identity U R.LPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGK.A + 2 Deamidated (NQ); Oxidation (M)
4465   1080.2522 4316.9797 4316.9856 -1.36 1 55 6.7e-006 +1Score > 16 indicates identity U R.QLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGK.A
4466   1080.7477 4318.9617 4318.9536 1.88 1 37 0.00034 +1Score > 15 indicates identity U R.QLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGK.A + 2 Deamidated (NQ)
4469   1084.5009 4333.9745 4333.9645 2.31 1 50 2.3e-005 +1Score > 17 indicates identity U R.QLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGK.A + Deamidated (NQ); Oxidation (M)
4470 +1 1084.5111 4334.0153 4333.9645 11.7 1 74 1.2e-007 +1Score > 17 indicates identity U R.QLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGK.A + Deamidated (NQ); Oxidation (M)
4526 +1 748.2363 4483.3741 4483.3508 5.20 1 6 0.31 +1Score > 13 indicates identity U R.QTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVR.W + Deamidated (NQ)
4527   897.6830 4483.3786 4483.3508 6.20 1 2 0.81 +1Score > 13 indicates identity U R.QTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVR.W + Deamidated (NQ)
4529   748.4059 4484.3917 4484.3348 12.7 1 6 0.27 +1Score > 13 indicates identity U R.QTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVR.W + 2 Deamidated (NQ)
4536   750.9057 4499.3905 4499.3457 9.96 1 15 0.036 +1Score > 13 indicates identity U R.QTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVR.W + Deamidated (NQ); Oxidation (M)
4537   750.9059 4499.3917 4499.3457 10.2 1 14 0.045 +1Score > 13 indicates identity U R.QTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVR.W + Deamidated (NQ); Oxidation (M)
4538 +1 901.0850 4500.3886 4500.3297 13.1 1 9 0.12 +1Score > 13 indicates identity U R.QTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVR.W + 2 Deamidated (NQ); Oxidation (M)
4541 +1 643.9212 4500.3975 4500.3297 15.0 1 10 0.092 +1Score > 13 indicates identity U R.QTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVR.W + 2 Deamidated (NQ); Oxidation (M)
4543 +1 751.0745 4500.4033 4500.3297 16.4 1 16 0.026 +1Score > 13 indicates identity U R.QTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVR.W + 2 Deamidated (NQ); Oxidation (M)
4602   955.5224 4772.5756 4772.4847 19.0 1 18 0.017 +1Score > 13 indicates identity U K.ISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVR.H + 2 Deamidated (NQ); Oxidation (M)

1 subset or intersection (1 subset protein in total)

Score Mass Subset of
YHJD_ECOLI 29 0 1.1
description

+2

Accession Score Description
1 PEPB_ECOLI 1618 Peptidase B OS=Escherichia coli (strain K12) GN=pepB PE=3 SV=2

+3

Accession Score Description
1 IADA_ECOLI 651 Isoaspartyl dipeptidase OS=Escherichia coli (strain K12) GN=iadA PE=1 SV=1

+4

Accession Score Description
1 CODA_ECOLI 463 Cytosine deaminase OS=Escherichia coli (strain K12) GN=codA PE=1 SV=3

+5

Accession Score Description
1 ALF1_ECOLI 333 Fructose-bisphosphate aldolase class 1 OS=Escherichia coli (strain K12) GN=fbaB PE=1 SV=2

+6

Accession Score Description
1 CATNterm_ECOLX 324 Chloramphenicol acetyltransferase with N-terminal tag OS=Escherichia coli GN=cat PE=1 SV=1

+7

Accession Score Description
1 YGEY_ECOLI 280 Uncharacterized protein YgeY OS=Escherichia coli (strain K12) GN=ygeY PE=3 SV=1

+8

Accession Score Description
1 KDSC_ECOLI 270 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC OS=Escherichia coli (strain K12) GN=kdsC PE=1 SV=1

+9

Accession Score Description
1 TRYP_PIG 263 Trypsin OS=Sus scrofa PE=1 SV=1

+10

Accession Score Description
1 GLDA_ECOLI 261 Glycerol dehydrogenase OS=Escherichia coli (strain K12) GN=gldA PE=1 SV=1
Page: 1 2 3 4 5 6  7 Next 

Not what you expected? Try the select summary.