MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1258_JBEI_Tube1_A1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 24 Jun 2025 at 18:33:55 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,568

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 4077)


Page: Previous 1 2 3 4 5 6 7 8 9  41 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2722 608.2728 1214.5310 1214.5424 -9.31 0 1 0.75 +1Score > 13 indicates identity GAMYTEAMVAR + Oxidation (M)
2803 431.8824 1292.6254 1292.6249 0.39 0 1 3.4 +1Score > 19 indicates identity DYDTGLPTQGVK
2423 445.7555 889.4964 889.4909 6.21 0 1 2.5 +1Score > 18 indicates identity DVYPVLGK
3757 630.3058 2517.1941 2517.1958 -0.69 1 1 3.2 +1Score > 19 indicates identity TTLSDVGATVCEFFNAKAPYNGR
3796 864.1200 2589.3382 2589.3009 14.4 1 1 2.4 +1Score > 17 indicates identity LANRTGFISHFVIEGEAMAQQLR + 2 Deamidated (NQ)
4100 789.9302 3155.6917 3155.6350 18.0 1 1 0.95 +1Score > 13 indicates identity ATFVVDPQGIIQAIEVTAEGIGRDASDLLR + 2 Deamidated (NQ)
3736 832.4115 2494.2127 2494.2299 -6.91 1 1 3.5 +1Score > 19 indicates identity ALEALSAEDGHDDVGQRLESLLR + Deamidated (NQ)
2498 491.7225 981.4304 981.4265 4.07 0 1 1.2 +1Score > 14 indicates identity FSSSGGGGGGGR
3025 758.8926 1515.7706 1515.7933 -14.9 0 1 3.4 +1Score > 19 indicates identity LIAQLDPVGTAFNR + 2 Deamidated (NQ)
3646 790.0607 2367.1603 2367.1382 9.31 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
AFSQFLNLANTAEQYHSISPK + 2 Deamidated (NQ)
3228 574.6270 1720.8592 1720.8784 -11.2 1 1 3.9 +1Score > 20 indicates identity KVGVGLGTNYEEWLR + Deamidated (NQ)
3532 449.8011 2243.9691 2243.9973 -12.6 1 1 1.4 +1Score > 15 indicates identity IMLRTEHDNEEMSVPMHK + 3 Oxidation (M)
4192 692.3633 3456.7801 3456.7203 17.3 0 1 2.5 +1Score > 18 indicates identity MGVKPGGNIALLACAGPMGIGAIDYAINGGIQPSR + 2 Deamidated (NQ); Oxidation (M)
4221 709.9611 3544.7691 3544.7798 -3.02 1 1 3.4 +1Score > 19 indicates identity QGQVVESGLTDRVLDDPHHPYTQLLVSSVLQN + Deamidated (NQ)
3058 385.6829 1538.7025 1538.7212 -12.2 0 1 2.6 +1Score > 18 indicates identity LSGVTEALNYNDSR + Deamidated (NQ)
4505 1164.0566 4652.1973 4652.2752 -16.7 1 1 1.9 +1Score > 16 indicates identity LSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIR + 2 Deamidated (NQ); Oxidation (M)
2720 607.8588 1213.7030 1213.6918 9.28 0 1 1.4 +1Score > 15 indicates identity ILIGEVQSVEK
4145 819.6515 3274.5769 3274.6405 -19.4 1 1 3.2 +1Score > 19 indicates identity GLFAVGECSSVGLHGANRLGSNSLAELVVFGR + 2 Deamidated (NQ)
2699 401.1953 1200.5641 1200.5557 6.98 0 1 1.9 +1Score > 16 indicates identity QISELSCHAR + Deamidated (NQ)
3018 754.4117 1506.8088 1506.8194 -7.03 0 1 2.6 +1Score > 18 indicates identity QPVYQLYTLLNR
3661 795.4310 2383.2712 2383.2641 2.96 1 1 2 +1Score > 16 indicates identity NLQQLNAQMAQEAINLTRALK + Oxidation (M)
2852 446.5540 1336.6402 1336.6479 -5.77 0 1 2.5 +1Score > 17 indicates identity ASLMSMTPTLNR + Oxidation (M)
2729 610.2959 1218.5772 1218.5741 2.56 1 1 3.4 +1Score > 19 indicates identity RQFNASDPQR + Deamidated (NQ)
3220 571.9440 1712.8102 1712.8441 -19.8 1 1 2.9 +1Score > 18 indicates identity RIIISEEQGSNSHSR + Deamidated (NQ)
3564 765.3893 2293.1461 2293.1624 -7.13 0 1 3.7 +1Score > 19 indicates identity LNVIFSCGTGDIVDLSSLDLR
3502 549.2681 2193.0433 2193.0571 -6.31 0 1 3.5 +1Score > 19 indicates identity WSLVGEHNMHNGLMAIAAAR + Oxidation (M)
4451 739.1827 4429.0525 4429.1393 -19.6 1 1 2.7 +1Score > 18 indicates identity INIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTR + Oxidation (M)
3727 827.4221 2479.2445 2479.2529 -3.41 1 1 3.6 +1Score > 19 indicates identity HVGFQSMVEDILQIAERHLQK + 2 Deamidated (NQ)
3710 820.1061 2457.2965 2457.3130 -6.75 0 1 2.6 +1Score > 17 indicates identity VTYTWLGIAVAMAFTSIPFVVR + Oxidation (M)
3774 852.1107 2553.3103 2553.3115 -0.48 1 1 3.3 +1Score > 18 indicates identity LREDFIAYLDGFSPNVQEVLTK
3637 784.7298 2351.1676 2351.2121 -18.9 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
ERLIEEGVDVPEGLAVDWIGR
3809 877.4447 2629.3123 2629.3614 -18.7 1 1 3.7 +1Score > 19 indicates identity VQLFDMFPHTAHYEVLTLLVKQ + Deamidated (NQ)
2489 486.7337 971.4528 971.4672 -14.8 1 1 1.4 +1Score > 15 indicates identity KSATDHGEK
2903 469.2072 1404.5998 1404.6013 -1.09 0 1 0.96 +1Score > 13 indicates identity ANMLAHMETQNK + 2 Deamidated (NQ); Oxidation (M)
2959 485.9572 1454.8498 1454.8279 15.1 1 1 0.83 +1Score > 13 indicates identity LMRLIQANPALSK + Deamidated (NQ)
3730 827.4258 2479.2556 2479.2186 14.9 1 1 3.3 +1Score > 18 indicates identity SGCVGVLIGIESIEEESLKSMNK + Deamidated (NQ)
4547 946.6191 5673.6709 5673.5960 13.2 1 1 1.5 +1Score > 15 indicates identity EIDPHTNYLSPRNTEQFNTEMSLSLEGIGAVLQMDDDYTVINSMVAGGPAAK + 3 Deamidated (NQ); 2 Oxidation (M)
4286 735.5810 3672.8686 3672.8379 8.36 0 1 2.5 +1Score > 17 indicates identity GGVGTTTITAALAWSLQMLGENVLVVDACPDNLLR + 2 Deamidated (NQ); Oxidation (M)
4269 604.9808 3623.8411 3623.7826 16.2 0 1 2.3 +1Score > 17 indicates identity TMGAVEMGWIQTGLEYQAFHTLAILGLAVAMQR + 2 Deamidated (NQ); Oxidation (M)
4311 529.8566 3701.9453 3701.9570 -3.16 1 1 1.3 +1Score > 15 indicates identity QGLNAIWPRIIALVVQPGVEFDHTNVIDYQPAK + Deamidated (NQ)
2912 471.2684 1410.7834 1410.8082 -17.6 0 1 1.8 +1Score > 16 indicates identity ERPVLTVQLLDK + Deamidated (NQ)
3219 571.9433 1712.8081 1712.8369 -16.8 1 1 2.9 +1Score > 18 indicates identity ENSESLLNRFFLSR + 2 Deamidated (NQ)
3379 670.3703 2008.0891 2008.0993 -5.08 1 1 2 +1Score > 16 indicates identity ILRLLLQNGADPEWIQK + 2 Deamidated (NQ)
4313 617.9985 3701.9473 3701.8875 16.2 1 1 1.3 +1Score > 14 indicates identity LKPQNNLPELISGWRGELMAEALHNLLQEYPQ + Deamidated (NQ)
3356 661.9807 1982.9203 1982.9005 9.96 0 1 2.8 +1Score > 18 indicates identity MSIESLNAFSMDFFSLK + Deamidated (NQ); Oxidation (M)
3488 546.2820 2181.0989 2181.0589 18.3 0 1 3.7 +1Score > 19 indicates identity ENNGYALEDLYDANGVLIAK
3477 724.7255 2171.1547 2171.1222 15.0 1 1 2.2 +1Score > 17 indicates identity SSSGNRLLIEQQLADKPWK + 2 Deamidated (NQ)
2730 611.7963 1221.5780 1221.5659 9.91 0 1 3.6 +1Score > 19 indicates identity ATPSSTDQMLR + Oxidation (M)
4015 964.8030 2891.3872 2891.3820 1.79 0 1 3.9 +1Score > 19 indicates identity AQLLVDEMSTIQSNMITYATAFGQIK + 3 Deamidated (NQ); Oxidation (M)
4333 961.4846 3841.9093 3841.9230 -3.57 1 1 2.7 +1Score > 18 indicates identity QVVEQNAIAKSCAMIVAADEFIPGNGIPVDSVVIDR + Deamidated (NQ); Oxidation (M)
4455 739.3466 4430.0359 4430.1233 -19.7 1 1 2.5 +1Score > 17 indicates identity INIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTR + Deamidated (NQ); Oxidation (M)
4208 703.1420 3510.6736 3510.7413 -19.3 1 1 4 +1Score > 19 indicates identity IGDRIAIMQNGEVVQVGTPDEILNNPANDYVR + Deamidated (NQ)
2928 715.3658 1428.7170 1428.7442 -19.0 0 1 4 +1Score > 19 indicates identity LIALFYGDWGFK
2820 654.3616 1306.7086 1306.7146 -4.55 1 1 1.8 +1Score > 16 indicates identity QVFPLTGRYAR
3541 751.7755 2252.3047 2252.2926 5.36 0 1 0.86 +1Score > 13 indicates identity AQALSLIATGTALAMVLGLPLGR + Oxidation (M)
2340 391.1964 780.3782 780.3800 -2.21 0 1 2.5 +1Score > 17 indicates identity SSSTMLR
2424 445.7563 889.4980 889.4909 8.01 0 1 2.9 +1Score > 18 indicates identity DVYPVLGK
3451 706.0275 2115.0607 2115.0776 -7.98 0 1 4 +1Score > 19 indicates identity GENIQVWIEPVVFNDLLK + 3 Deamidated (NQ)
4546 946.6167 5673.6565 5673.5960 10.7 1 1 1.6 +1Score > 15 indicates identity EIDPHTNYLSPRNTEQFNTEMSLSLEGIGAVLQMDDDYTVINSMVAGGPAAK + 3 Deamidated (NQ); 2 Oxidation (M)
2857 448.8522 1343.5348 1343.5551 -15.1 0 1 0.87 +1Score > 13 indicates identity GTGNETNYVMQK + 3 Deamidated (NQ)
3002 500.6102 1498.8088 1498.8256 -11.3 1 1 3 +1Score > 18 indicates identity FDRQVVVGLPDVR
3166 556.9997 1667.9773 1667.9458 18.9 1 1 0.87 +1Score > 13 indicates identity LPNPTLAVTDGKTTIK
4471 901.6293 4503.1101 4503.0767 7.41 1 1 2.2 +1Score > 16 indicates identity IYLIEMESDDPANALPSTDKAVSDNDDMMILVVDDHPINR + 2 Oxidation (M)
2958 728.4305 1454.8464 1454.8245 15.1 1 1 0.88 +1Score > 13 indicates identity WVSAERGIISPLK
2485 484.7436 967.4726 967.4909 -18.9 0 1 3 +1Score > 18 indicates identity LPMHASGAGK
3385 1012.5250 2023.0354 2023.0659 -15.1 0 1 3.5 +1Score > 18 indicates identity MEQSLIPQTPVLPLTAQR + 2 Deamidated (NQ)
3395 1030.5288 2059.0430 2059.0639 -10.1 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WLFSFAGAPRPDNPKSIR + Deamidated (NQ)
4390 690.5377 4137.1825 4137.1633 4.64 1 1 0.89 +1Score > 13 indicates identity ETTFTGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGR + 2 Deamidated (NQ)
2702 401.5190 1201.5352 1201.5285 5.56 0 0 1.6 +1Score > 15 indicates identity DPNVQMVPER + 2 Deamidated (NQ); Oxidation (M)
3429 696.3511 2086.0315 2086.0364 -2.37 0 0 3.7 +1Score > 19 indicates identity VLMQAQQALLNAEIDQQR + 2 Deamidated (NQ); Oxidation (M)
3755 504.4447 2517.1871 2517.2169 -11.8 1 0 3.7 +1Score > 19 indicates identity MDSLNLNKHISGQFNAELESIR + 2 Deamidated (NQ)
3325 947.9943 1893.9740 1893.9544 10.4 1 0 4 +1Score > 19 indicates identity VHRGDLVVEGNIESNQK + Deamidated (NQ)
3309 938.4902 1874.9658 1874.9673 -0.76 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MQTFQADLAIVGAGGAGLR
4069 1015.8707 3044.5903 3044.6448 -17.9 1 0 2.3 +1Score > 17 indicates identity LLTPSQFTFVFQQPQRAGTPQITILGR + Deamidated (NQ)
4337 971.4824 3881.9005 3881.8366 16.5 0 0 2.9 +1Score > 18 indicates identity LHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVK + Deamidated (NQ)
2426 447.7496 893.4846 893.4858 -1.32 0 0 2.2 +1Score > 16 indicates identity FAQLSTVK + Deamidated (NQ)
3815 881.0868 2640.2386 2640.2299 3.29 1 0 3.6 +1Score > 18 indicates identity TQAEKFTLGEPGVALNDVMTDMQK + 2 Deamidated (NQ); Oxidation (M)
4178 1144.2657 3429.7753 3429.7409 10.0 1 0 2.1 +1Score > 16 indicates identity GMQVALGTNAVRVAAASAGGIVGSLSQSQLGNLGEK + 3 Deamidated (NQ); Oxidation (M)
2684 396.5697 1186.6873 1186.6822 4.27 1 0 1.7 +1Score > 15 indicates identity RELLPYLQR
3329 632.3361 1893.9865 1893.9870 -0.25 1 0 3.5 +1Score > 18 indicates identity NPTMESLDAIIKHPSIK + Deamidated (NQ)
3751 838.4280 2512.2622 2512.2922 -11.9 1 0 4.5 +1Score > 19 indicates identity TGVEAKVNNNLSLWGNVGVQLGDK + Deamidated (NQ)
4074 1018.5396 3052.5970 3052.5678 9.55 0 0 2.1 +1Score > 16 indicates identity ALAMEPEVLLFDEPTSALDPELVGEVLR
3959 934.7904 2801.3494 2801.3658 -5.86 0 0 3.9 +1Score > 19 indicates identity MLLAGMALSTAFTMLLMMLQASGDPR + 2 Oxidation (M)
4258 721.1834 3600.8806 3600.8709 2.70 1 0 1.8 +1Score > 16 indicates identity AAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPK + Deamidated (NQ); Oxidation (M)
4304 617.9976 3701.9419 3701.8875 14.7 1 0 1.5 +1Score > 15 indicates identity LKPQNNLPELISGWRGELMAEALHNLLQEYPQ + Deamidated (NQ)
3099 400.4463 1597.7561 1597.7632 -4.47 1 0 3.4 +1Score > 18 indicates identity GVEPLMKMSWNYK + Oxidation (M)
3278 601.3148 1800.9226 1800.9523 -16.5 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WIADVGFGGQTLTAPIR
2854 447.2094 1338.6064 1338.5907 11.7 0 0 2 +1Score > 16 indicates identity QAESMLESMASR
4027 973.8591 2918.5555 2918.5059 17.0 0 0 1.5 +1Score > 15 indicates identity IITTVLQMVVNSIDYGLNVAEATNAPR + Deamidated (NQ); Oxidation (M)
3673 481.0377 2400.1521 2400.1768 -10.3 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
DELLALIRDSGQNDLIDEDTR
4426 837.4196 4182.0616 4182.0078 12.9 0 0 3.2 +1Score > 18 indicates identity EAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYR + Oxidation (M)
3346 652.3598 1954.0576 1954.0385 9.78 1 0 2.6 +1Score > 17 indicates identity TVAGLGGQAGRLAEWVVDR
3650 593.5564 2370.1965 2370.2213 -10.5 1 0 3.7 +1Score > 18 indicates identity METKDLIVIGGGINGAGIAADAAGR + Deamidated (NQ)
4054 1004.8751 3011.6035 3011.6042 -0.24 1 0 1.9 +1Score > 16 indicates identity VSMIFLQYGQIDVIDGAFVLIDKTGIR + Deamidated (NQ)
4261 723.5807 3612.8671 3612.8192 13.3 1 0 2.8 +1Score > 17 indicates identity MKIIILGAGQVGGTLAENLVGENNDITVVDTNGER + 3 Deamidated (NQ)
2593 538.7774 1075.5402 1075.5509 -9.94 1 0 4.1 +1Score > 19 indicates identity SETIDKQVR + Deamidated (NQ)
2929 715.8576 1429.7006 1429.7161 -10.8 1 0 3 +1Score > 18 indicates identity IIQRNQDNSDVK + Deamidated (NQ)
3081 522.5945 1564.7617 1564.7555 3.94 1 0 4.1 +1Score > 19 indicates identity KVNYSQIDPALCR + 2 Deamidated (NQ)
3024 506.2620 1515.7642 1515.7753 -7.37 1 0 4.1 +1Score > 19 indicates identity DGLLTRNSNGNSLR
4011 962.8080 2885.4022 2885.4076 -1.89 1 0 4.4 +1Score > 19 indicates identity LQQDEVSDSERQQLMQSVNPALVLR + 3 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9  41 Next 

Not what you expected? Try the select summary.