| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1258_JBEI_Tube1_A1.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 24 Jun 2025 at 18:33:55 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,568 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 545.3314 | 544.3241 | 544.3221 | 3.81 | 0 | 22 | 0.091 | 1Score > 24 indicates identity |
AVEVK | |
| 531.3167 | 530.3094 | 530.3064 | 5.74 | 0 | 20 | 0.1 | 1Score > 23 indicates identity |
IAEAK | |
| 351.2200 | 700.4254 | 700.4232 | 3.27 | 1 | 19 | 0.074 | 1Score > 20 indicates identity |
LGDKLR | |
| 625.9724 | 1874.8954 | 1874.9295 | -18.2 | 0 | 18 | 0.067 | 1Score > 19 indicates identity |
QDILLLDGAMATELEAR + Deamidated (NQ); Oxidation (M) | |
| 522.9312 | 1565.7718 | 1565.7838 | -7.69 | 0 | 18 | 0.061 | 1Score > 19 indicates identity |
TDPTSAFGGIIAFNR | |
| 614.8373 | 1227.6600 | 1227.6571 | 2.40 | 1 | 18 | 0.081 | 1Score > 19 indicates identity |
QRLDAINQLR + 2 Deamidated (NQ) | |
| 377.8791 | 1130.6155 | 1130.6230 | -6.65 | 1 | 17 | 0.076 | 1Score > 18 indicates identity |
MRQALELVR + Oxidation (M) | |
| 435.2218 | 1302.6436 | 1302.6238 | 15.2 | 0 | 16 | 0.12 | 1Score > 19 indicates identity |
DSTMIIISHDR + Oxidation (M) | |
| 437.2260 | 872.4374 | 872.4352 | 2.62 | 0 | 16 | 0.09 | 1Score > 18 indicates identity |
QAQQELR + Deamidated (NQ) | |
| 614.8369 | 1227.6592 | 1227.6571 | 1.75 | 1 | 15 | 0.13 | 1Score > 19 indicates identity |
QRLDAINQLR + 2 Deamidated (NQ) | |
| 428.7678 | 855.5210 | 855.5178 | 3.81 | 0 | 15 | 0.062 | 1Score > 16 indicates identity |
LASVLTPR | |
| 859.7708 | 2576.2906 | 2576.2394 | 19.9 | 1 | 15 | 0.16 | 1Score > 19 indicates identity |
QANDLDYASLPDSVVEQVRAAWK + 2 Deamidated (NQ) | |
| 382.8607 | 1145.5603 | 1145.5499 | 9.07 | 0 | 14 | 0.15 | 1Score > 19 indicates identity |
LNGITMPNNR + Deamidated (NQ); Oxidation (M) | |
| 602.7953 | 1203.5760 | 1203.5884 | -10.2 | 1 | 13 | 0.18 | 1Score > 18 indicates identity |
GNFQPDEKLR + Deamidated (NQ) | |
| 767.3791 | 1532.7436 | 1532.7219 | 14.2 | 1 | 13 | 0.21 | 1Score > 19 indicates identity |
RDPNQTEFAQAVR + 2 Deamidated (NQ) | |
| 373.1972 | 744.3798 | 744.3919 | -16.1 | 0 | 13 | 0.15 | 1Score > 17 indicates identity |
WGIVNR + Deamidated (NQ) | |
| 391.5435 | 1171.6087 | 1171.5873 | 18.2 | 1 | 13 | 0.18 | 1Score > 18 indicates identity |
DYSKYLNIR + Deamidated (NQ) | |
| 614.8394 | 1227.6642 | 1227.6571 | 5.82 | 1 | 13 | 0.22 | 1Score > 19 indicates identity |
QRLDAINQLR + 2 Deamidated (NQ) | |
| 531.2899 | 530.2826 | 530.2813 | 2.59 | 0 | 13 | 0.51 | 1Score > 22 indicates identity |
AGIDR | |
| 544.7792 | 1087.5438 | 1087.5258 | 16.6 | 1 | 13 | 0.23 | 1Score > 19 indicates identity |
GNNRQIDIR + 3 Deamidated (NQ) | |
| 405.9560 | 1619.7949 | 1619.7831 | 7.28 | 1 | 13 | 0.23 | 1Score > 19 indicates identity |
SFKLYLNSFNQTR + 3 Deamidated (NQ) | |
| 406.8715 | 1217.5927 | 1217.6148 | -18.2 | 0 | 13 | 0.27 | 1Score > 19 indicates identity |
SMGCGLLSLAPL | |
| 533.7459 | 1065.4772 | 1065.4727 | 4.29 | 0 | 12 | 0.12 | 1Score > 16 indicates identity |
YQSASPEQR + Deamidated (NQ) | |
| 701.4331 | 700.4258 | 700.4232 | 3.81 | 1 | 12 | 0.35 | 1Score > 20 indicates identity |
LGDKLR | |
| 460.2791 | 459.2718 | 459.2805 | -18.9 | 1 | 12 | 0.65 | 1Score > 23 indicates identity |
KAGGK | |
| 619.3644 | 1236.7142 | 1236.7302 | -12.9 | 1 | 12 | 0.066 | 1Score > 13 indicates identity |
TISAAARHAVIK | |
| 745.3874 | 744.3801 | 744.3766 | 4.75 | 0 | 12 | 0.21 | 1Score > 17 indicates identity |
NEINVR + Deamidated (NQ) | |
| 772.4678 | 771.4605 | 771.4603 | 0.33 | 1 | 12 | 0.35 | 1Score > 20 indicates identity |
KQIQVR + Deamidated (NQ) | |
| 599.3423 | 1196.6700 | 1196.6666 | 2.89 | 1 | 11 | 0.14 | 1Score > 15 indicates identity |
DVIPFPRTPR | |
| 515.3320 | 514.3247 | 514.3227 | 3.89 | 0 | 11 | 0.65 | 1Score > 22 indicates identity |
GAIVR | |
| 512.7387 | 1023.4628 | 1023.4733 | -10.3 | 1 | 11 | 0.16 | 1Score > 16 indicates identity |
QTRNYDAR + Deamidated (NQ) | |
| 518.2727 | 517.2654 | 517.2608 | 8.84 | 0 | 11 | 0.48 | 1Score > 20 indicates identity |
NGATR | |
| 500.9357 | 1499.7853 | 1499.8096 | -16.3 | 1 | 11 | 0.34 | 1Score > 19 indicates identity |
FDRQVVVGLPDVR + Deamidated (NQ) | |
| 516.3011 | 1030.5876 | 1030.5771 | 10.2 | 1 | 11 | 0.21 | 1Score > 16 indicates identity |
ETSRGGLAIK | |
| 614.8373 | 1227.6600 | 1227.6823 | -18.1 | 0 | 11 | 0.4 | 1Score > 19 indicates identity |
QSLNSLLSPLR + Deamidated (NQ) | |
| 421.7237 | 841.4328 | 841.4294 | 4.14 | 0 | 10 | 0.12 | 1Score > 14 indicates identity |
VENPDLR | |
| 503.2975 | 502.2902 | 502.2863 | 7.72 | 0 | 10 | 0.3 | 1Score > 22 indicates identityScore > 18 indicates homology |
LGGTR | |
| 386.5656 | 1156.6750 | 1156.6928 | -15.4 | 1 | 10 | 0.26 | 1Score > 16 indicates identity |
ILTEGRTVIR | |
| 505.2618 | 1008.5090 | 1008.5280 | -18.8 | 0 | 10 | 0.43 | 1Score > 19 indicates identity |
EFFGLTKPA | |
| 558.6513 | 1672.9321 | 1672.9004 | 18.9 | 1 | 10 | 0.21 | 1Score > 15 indicates identity |
NAMLDIGLAMPVKIR + 2 Oxidation (M) | |
| 382.8609 | 1145.5609 | 1145.5499 | 9.59 | 0 | 10 | 0.44 | 1Score > 19 indicates identity |
LNGITMPNNR + Deamidated (NQ); Oxidation (M) | |
| 674.3275 | 1346.6404 | 1346.6619 | -15.9 | 0 | 10 | 0.35 | 1Score > 18 indicates identity |
QFSPHSFQQLK + Deamidated (NQ) | |
| 479.7737 | 957.5328 | 957.5495 | -17.4 | 0 | 10 | 0.42 | 1Score > 18 indicates identity |
VKPSSAELK | |
| 574.7689 | 1147.5232 | 1147.5430 | -17.3 | 1 | 10 | 0.28 | 1Score > 16 indicates identity |
LPQEEKMEK + Deamidated (NQ); Oxidation (M) | |
| 833.7842 | 2498.3308 | 2498.3454 | -5.87 | 0 | 10 | 0.22 | 1Score > 16 indicates identity |
TVTSQVLIFEIMPAPPAIASQLR + Deamidated (NQ); Oxidation (M) | |
| 471.7907 | 941.5668 | 941.5480 | 20.0 | 0 | 9 | 0.21 | 1Score > 15 indicates identity |
LQLKPGMR | |
| 730.4267 | 729.4194 | 729.4133 | 8.38 | 1 | 9 | 0.46 | 1Score > 18 indicates identity |
QKLGER | |
| 535.8098 | 1069.6050 | 1069.5954 | 9.04 | 1 | 9 | 0.28 | 1Score > 16 indicates identity |
HIKMAIVDK + Oxidation (M) | |
| 762.7216 | 2285.1430 | 2285.1077 | 15.5 | 1 | 9 | 0.54 | 1Score > 19 indicates identity |
LRFLTSSNPDHPTGNIFDPR + 2 Deamidated (NQ) | |
| 431.2230 | 1720.8629 | 1720.8757 | -7.47 | 1 | 9 | 0.58 | 1Score > 19 indicates identity |
DVDFASLRHQHIGAR | |
| 438.8654 | 1313.5744 | 1313.5809 | -4.97 | 0 | 9 | 0.16 | 1Score > 14 indicates identity |
TEFNALMESEK + Oxidation (M) | |
| 949.5257 | 2845.5553 | 2845.5436 | 4.09 | 1 | 9 | 0.12 | 1Score > 13 indicates identity |
AIQQQIENPLAQQILSGELVPGKVIR + 4 Deamidated (NQ) | |
| 396.8646 | 1187.5720 | 1187.5895 | -14.7 | 1 | 9 | 0.4 | 1Score > 17 indicates identity |
RGVVDETEAGR | |
| 505.2611 | 1008.5076 | 1008.5240 | -16.2 | 0 | 9 | 0.58 | 1Score > 19 indicates identity |
YLSLAETGR | |
| 420.6945 | 839.3744 | 839.3748 | -0.48 | 0 | 9 | 0.16 | 1Score > 13 indicates identity |
TWFCAR | |
| 503.9364 | 1508.7874 | 1508.7875 | -0.058 | 0 | 9 | 0.49 | 1Score > 18 indicates identity |
QPVYQLYTLLNR + 2 Deamidated (NQ) | |
| 614.8386 | 1227.6626 | 1227.6571 | 4.52 | 1 | 9 | 0.58 | 1Score > 19 indicates identity |
QRLDAINQLR + 2 Deamidated (NQ) | |
| 634.0170 | 1899.0292 | 1899.0200 | 4.81 | 0 | 8 | 0.35 | 1Score > 16 indicates identity |
LAVGEALTNIAATQIGDIK + 2 Deamidated (NQ) | |
| 469.2509 | 1404.7309 | 1404.7469 | -11.4 | 1 | 8 | 0.62 | 1Score > 19 indicates identity |
KLVGANIAMDMVK + Oxidation (M) | |
| 503.2940 | 502.2867 | 502.2863 | 0.78 | 0 | 8 | 0.69 | 1Score > 22 indicates identityScore > 19 indicates homology |
ISGAR | |
| 501.3162 | 500.3089 | 500.3071 | 3.74 | 0 | 8 | 0.73 | 1Score > 19 indicates identity |
ALAAR | |
| 745.3870 | 744.3797 | 744.3766 | 4.17 | 0 | 8 | 0.46 | 1Score > 17 indicates identity |
QDVDLR | |
| 435.7309 | 1738.8945 | 1738.8889 | 3.19 | 1 | 8 | 0.55 | 1Score > 18 indicates identity |
KIFNNLDNLSYIQR + 2 Deamidated (NQ) | |
| 571.8603 | 1141.7060 | 1141.7070 | -0.86 | 1 | 8 | 0.16 | 1Score > 13 indicates identity |
KQTALVELLK | |
| 634.3357 | 633.3284 | 633.3268 | 2.54 | 0 | 8 | 0.48 | 1Score > 17 indicates identity |
ALMQR + Oxidation (M) | |
| 344.5185 | 1030.5337 | 1030.5407 | -6.83 | 1 | 8 | 0.93 | 1Score > 20 indicates identity |
GKAVSDVAER | |
| 771.4027 | 770.3954 | 770.3922 | 4.13 | 0 | 8 | 0.22 | 1Score > 14 indicates identity |
GAEQPLR + Deamidated (NQ) | |
| 461.2723 | 460.2650 | 460.2645 | 1.05 | 0 | 8 | 0.73 | 1Score > 20 indicates identityScore > 19 indicates homology |
SAVGK | |
| 548.2820 | 1641.8242 | 1641.8508 | -16.2 | 1 | 8 | 0.59 | 1Score > 18 indicates identity |
MTKHTLEQLAADLR + Oxidation (M) | |
| 473.9252 | 1418.7538 | 1418.7518 | 1.42 | 0 | 8 | 0.79 | 1Score > 19 indicates identity |
HLSQEIPATPGIR + Deamidated (NQ) | |
| 822.1017 | 2463.2833 | 2463.2427 | 16.5 | 1 | 8 | 0.6 | 1Score > 18 indicates identity |
LQPGIYKNMGSNSVNIIINNTR + 2 Deamidated (NQ); Oxidation (M) | |
| 1081.5024 | 1080.4951 | 1080.4948 | 0.29 | 1 | 8 | 0.54 | 1Score > 17 indicates identity |
SDERYQQR | |
| 647.3433 | 646.3360 | 646.3286 | 11.5 | 0 | 8 | 0.84 | 1Score > 19 indicates identity |
ELETR | |
| 672.4062 | 671.3989 | 671.3966 | 3.45 | 0 | 8 | 0.83 | 1Score > 20 indicates identityScore > 19 indicates homology |
GNVLIR + Deamidated (NQ) | |
| 429.2120 | 428.2047 | 428.2020 | 6.48 | 0 | 7 | 0.18 | 1Score > 13 indicates identity |
APGGQ | |
| 586.0231 | 2340.0633 | 2340.0943 | -13.3 | 0 | 7 | 0.54 | 1Score > 17 indicates identity |
YLNNINGLLTSFCGADAPQLR + 4 Deamidated (NQ) | |
| 312.1618 | 622.3090 | 622.3074 | 2.57 | 0 | 7 | 0.64 | 1Score > 18 indicates identity |
YGNIR + Deamidated (NQ) | |
| 842.9329 | 1683.8512 | 1683.8502 | 0.64 | 0 | 7 | 0.81 | 1Score > 19 indicates identity |
ALTSSGFDAIMVISTR + Oxidation (M) | |
| 592.3439 | 1182.6732 | 1182.6833 | -8.49 | 1 | 7 | 0.3 | 1Score > 14 indicates identity |
LQVVDRNLAR | |
| 518.2724 | 1034.5302 | 1034.5331 | -2.78 | 1 | 7 | 0.91 | 1Score > 19 indicates identity |
QWKGLMTR + Oxidation (M) | |
| 642.3862 | 641.3789 | 641.3860 | -11.1 | 1 | 7 | 0.37 | 1Score > 15 indicates identity |
AGAKAPK | |
| 514.2638 | 513.2565 | 513.2659 | -18.4 | 0 | 7 | 0.23 | 1Score > 13 indicates identity |
GPGAGR | |
| 903.4179 | 902.4106 | 902.4093 | 1.43 | 0 | 7 | 0.43 | 1Score > 16 indicates identity |
QNLENQR + 2 Deamidated (NQ) | |
| 503.2720 | 1506.7942 | 1506.8194 | -16.8 | 0 | 7 | 0.79 | 1Score > 18 indicates identity |
QPVYQLYTLLNR | |
| 442.2200 | 1323.6382 | 1323.6129 | 19.1 | 0 | 7 | 0.68 | 1Score > 18 indicates identity |
MLSAFQLENNR + 2 Deamidated (NQ) | |
| 508.5998 | 1522.7776 | 1522.7701 | 4.92 | 0 | 7 | 0.83 | 1Score > 18 indicates identity |
ELIEMLYVNINR + Deamidated (NQ); Oxidation (M) | |
| 871.4776 | 1740.9406 | 1740.9192 | 12.3 | 1 | 7 | 0.52 | 1Score > 16 indicates identity |
QVRGDILNSMLPIER + Deamidated (NQ) | |
| 739.1828 | 4429.0531 | 4429.1393 | -19.5 | 1 | 7 | 0.71 | 1Score > 18 indicates identity |
INIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTR + Oxidation (M) | |
| 367.2043 | 732.3940 | 732.3952 | -1.62 | 0 | 7 | 1 | 1Score > 19 indicates identity |
MGLALGR + Oxidation (M) | |
| 400.2019 | 798.3892 | 798.3806 | 10.8 | 0 | 7 | 0.27 | 1Score > 13 indicates identity |
DGMHAIR | |
| 773.3802 | 1544.7458 | 1544.7617 | -10.2 | 1 | 7 | 1 | 1Score > 19 indicates identity |
LLNESPDAQVRMR + Deamidated (NQ); Oxidation (M) | |
| 561.9863 | 1682.9371 | 1682.9216 | 9.18 | 1 | 6 | 0.39 | 1Score > 15 indicates identity |
LAVHDVLTNIYNRR | |
| 322.7085 | 643.4024 | 643.4017 | 1.18 | 1 | 6 | 0.57 | 1Score > 21 indicates identityScore > 17 indicates homology |
IQKVR + Deamidated (NQ) | |
| 399.2106 | 1194.6100 | 1194.5880 | 18.4 | 1 | 6 | 0.77 | 1Score > 18 indicates identity |
NKGAYSLADEK | |
| 664.7889 | 1327.5632 | 1327.5822 | -14.3 | 1 | 6 | 0.27 | 1Score > 13 indicates identity |
VKECEEMMIK + 2 Oxidation (M) | |
| 541.3171 | 1080.6196 | 1080.6001 | 18.1 | 1 | 6 | 0.23 | 1Score > 13 indicates identity |
MKLNATYIK | |
| 566.6197 | 1696.8373 | 1696.8243 | 7.65 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
LIQDFDGIFNQTMR | |
| 779.4307 | 778.4234 | 778.4337 | -13.2 | 1 | 6 | 0.81 | 1Score > 18 indicates identity |
KHGNIPL + Deamidated (NQ) | |
| 506.5896 | 1516.7470 | 1516.7490 | -1.32 | 1 | 6 | 1.1 | 1Score > 19 indicates identity |
SHIMAAKAVANTMR + Deamidated (NQ); Oxidation (M) | |
| 437.2418 | 872.4690 | 872.4716 | -2.88 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
TLINEQR |
Not what you expected? Try
the select summary.