MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1249__2.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:45:54 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,602

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4272)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3730 614.2960 1839.8662 1839.8315 18.8 0 0 3.3 +1Score > 18 indicates identity YVWTTNGPEPLDYQR + 2 Deamidated (NQ)
4263 630.5433 2518.1441 2518.1805 -14.5 0 0 3.1 +1Score > 17 indicates identity FYTEDGNWDLVGNNTPIFFIR + Deamidated (NQ)
4524 993.7466 3970.9573 3970.9941 -9.27 1 0 3.6 +1Score > 18 indicates identity YTEALQQIGSSSNSKVVMMPLEASSLMGSIAGIAELVK + 2 Oxidation (M)
2616 355.4718 1063.3936 1063.4054 -11.1 0 0 1 +1Score > 13 indicates identity ENNEDDATR + Deamidated (NQ)
3019 668.8241 1335.6336 1335.6340 -0.27 1 0 3.9 +1Score > 18 indicates identity TEEEIVERGMK + Oxidation (M)
1 300.0849 299.0776
2 300.1505 299.1432
3 300.1812 299.1739
4 300.1818 299.1745
5 301.0590 300.0517
6 301.0598 300.0525
7 301.0600 300.0527
8 301.0608 300.0535
9 301.0972 300.0899
10 301.1040 300.0967
11 301.1053 300.0980
12 301.1055 300.0982
13 301.1056 300.0983
14 301.1236 300.1163
15 301.1301 300.1228
16 301.1404 300.1331
17 301.1414 300.1341
18 301.1420 300.1347
19 301.1420 300.1347
20 301.1421 300.1348
21 301.1422 300.1349
22 301.1423 300.1350
23 301.1424 300.1351
24 301.1425 300.1352
25 301.1426 300.1353
26 301.1426 300.1353
27 301.1427 300.1354
28 301.1428 300.1355
29 301.1428 300.1355
30 301.1428 300.1355
31 301.1429 300.1356
32 302.1969 301.1896
33 302.1974 301.1901
34 302.2343 301.2270
35 303.0749 302.0676
36 303.0764 302.0691
37 303.0838 302.0765
38 303.0839 302.0766
39 303.0842 302.0769
40 303.0844 302.0771
41 303.0847 302.0774
42 303.0852 302.0779
43 303.1123 302.1050
44 303.1207 302.1134
45 303.1207 302.1134
46 303.1209 302.1136
47 303.1209 302.1136
48 303.1210 302.1137
49 303.1211 302.1138
50 303.1212 302.1139
51 303.1215 302.1142
52 303.1217 302.1144
53 303.1424 302.1351
54 303.1578 302.1505
55 303.1580 302.1507
56 303.1581 302.1508
57 303.1784 302.1711
58 303.5975 302.5902
59 304.1622 303.1549
60 304.1625 303.1552
61 305.0677 304.0604
62 305.0984 304.0911
63 305.0990 304.0917
64 305.0994 304.0921
65 305.0996 304.0923
66 305.0997 304.0924
67 305.1003 304.0930
68 305.1003 304.0930
69 305.1004 304.0931
70 305.1005 304.0932
71 305.1007 304.0934
72 305.1363 304.1290
73 305.1364 304.1291
74 305.1367 304.1294
75 305.1368 304.1295
76 305.1368 304.1295
77 305.1369 304.1296
78 305.1370 304.1297
79 305.1370 304.1297
80 305.1370 304.1297
81 305.1371 304.1298
82 305.1371 304.1298
83 305.1372 304.1299
84 305.1374 304.1301
85 305.1374 304.1301
86 305.1374 304.1301
87 305.1375 304.1302
88 305.1375 304.1302
89 305.1377 304.1304
90 305.1377 304.1304
91 305.1378 304.1305
92 305.1581 304.1508
93 305.1728 304.1655
94 305.1731 304.1658
95 305.1734 304.1661
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/