MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1249__2.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:45:54 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,602

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 4272)

Page: Previous 1 2 3 4 5 6 7 8 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2389 310.1582 927.4528 927.4661 -14.4 0 3 0.8 +1Score > 15 indicates identity GLLPENER + Deamidated (NQ)
2737 394.2089 1179.6049 1179.6261 -18.0 1 3 1.5 +1Score > 18 indicates identity DHRNWLALR
3898 980.0395 1958.0644 1958.0320 16.6 0 3 1.2 +1Score > 17 indicates identity NNTTLLSAITLEAALQQR + 2 Deamidated (NQ)
3535 868.9810 1735.9474 1735.9468 0.35 1 3 1 +1Score > 16 indicates identity IVTEEVVVKNHNAVGK + Deamidated (NQ)
3632 444.7264 1774.8765 1774.9036 -15.3 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology		 SGITLPTREMWAQLR + Deamidated (NQ); Oxidation (M)
4145 567.0674 2264.2405 2264.2092 13.8 0 3 0.82 +1Score > 15 indicates identity SYPITIASGLFNEPASFLPLK
2623 356.1640 1065.4702 1065.4761 -5.53 0 3 0.82 +1Score > 15 indicates identity TMLQQQGSR + 2 Deamidated (NQ); Oxidation (M)
2078 322.1648 642.3150 642.3085 10.1 0 3 0.48 +1Score > 13 indicates identity HTTER
3153 349.1903 1392.7321 1392.7136 13.3 1 3 1.4 +1Score > 17 indicates identity EDVQAYVKEAIK + Deamidated (NQ)
3541 435.2404 1736.9325 1736.9420 -5.50 1 3 1.3 +1Score > 17 indicates identity VNQPQDLGIALARAIR + 3 Deamidated (NQ)
2610 527.8055 1053.5964 1053.5818 13.9 1 3 0.65 +1Score > 14 indicates identity ANNKVGLAPVA + Deamidated (NQ)
3574 438.7353 1750.9121 1750.9254 -7.58 1 3 1.6 +1Score > 18 indicates identity AFKDLGFDSLAAVELR
4060 688.3211 2061.9415 2061.9347 3.30 1 3 1.9 +1Score > 19 indicates identity MSSMTTTDNKAFLNELAR + Deamidated (NQ); 2 Oxidation (M)
3500 857.9937 1713.9728 1713.9625 6.05 1 3 0.59 +1Score > 13 indicates identity GVELLSTGGTARLLAEK
4051 514.7552 2054.9917 2054.9612 14.8 1 3 2.5 +1Score > 20 indicates identity TAMSSNIELASAEVMKQGR + Deamidated (NQ); 2 Oxidation (M)
3927 994.5030 1986.9914 1987.0295 -19.2 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology		 TLTIAAPGAASMQLAENALK + Deamidated (NQ); Oxidation (M)
4166 782.0927 2343.2563 2343.3022 -19.6 1 3 1.4 +1Score > 17 indicates identity NIALQAAQPLVHGVSLTLQRGR + 2 Deamidated (NQ)
4016 509.2581 2033.0033 2032.9710 15.9 1 3 2.4 +1Score > 19 indicates identity QDAVQHAQQLLKMMGYGV + Deamidated (NQ); Oxidation (M)
4050 1028.0333 2054.0520 2054.0756 -11.5 1 3 2 +1Score > 18 indicates identity QTQTPRNLSIISPTGLGDR + Deamidated (NQ)
4199 805.7601 2414.2585 2414.2378 8.57 1 3 2.1 +1Score > 19 indicates identity FVEGKPLMLEDSYMPVKLFR + Oxidation (M)
2729 585.7927 1169.5708 1169.5863 -13.2 0 3 1.4 +1Score > 17 indicates identity LQLANVSCHK + Deamidated (NQ)
3010 443.8973 1328.6701 1328.6738 -2.78 1 3 2.1 +1Score > 19 indicates identity YQKINAHHYR
2845 418.1851 1251.5335 1251.5441 -8.50 0 3 0.6 +1Score > 13 indicates identity MFEINPVNNR + 3 Deamidated (NQ); Oxidation (M)
3057 340.9355 1359.7129 1359.7068 4.49 0 3 0.93 +1Score > 20 indicates identity
Score > 15 indicates homology		 MQLEVVDILER + Oxidation (M)
3581 438.7429 1750.9425 1750.9254 9.78 1 3 1.3 +1Score > 16 indicates identity AFKDLGFDSLAAVELR
2868 419.8875 1256.6407 1256.6513 -8.46 0 3 1.9 +1Score > 18 indicates identity IAIAVGNADAWR + Deamidated (NQ)
2283 412.2290 822.4434 822.4422 1.56 1 3 1.2 +1Score > 16 indicates identity LKEFMR
2734 393.5333 1177.5781 1177.5615 14.1 0 3 0.94 +1Score > 20 indicates identity
Score > 15 indicates homology		 LNIDDVDFAR + Deamidated (NQ)
2113 333.1911 664.3676 664.3544 19.9 0 3 1.7 +1Score > 17 indicates identity EIFTR
3844 962.4358 1922.8570 1922.8462 5.65 1 3 1.2 +1Score > 16 indicates identity EQGMEGARDLALEMANR + Deamidated (NQ); 2 Oxidation (M)
4280 846.4172 2536.2298 2536.1870 16.9 0 3 2.5 +1Score > 19 indicates identity NLNSIPAFDDNYIWVLNDEAGR + Deamidated (NQ)
3479 565.9932 1694.9578 1694.9679 -5.95 0 3 0.81 +1Score > 14 indicates identity LLANRPESALAVTLAR + Deamidated (NQ)
4173 593.0709 2368.2545 2368.2386 6.70 1 3 1.7 +1Score > 18 indicates identity SLVEAAFSQLSAERSFASLSLR
2538 337.8151 1010.4235 1010.4305 -6.95 0 3 0.71 +1Score > 14 indicates identity DGTFTNAER + Deamidated (NQ)
3790 940.4628 1878.9110 1878.8782 17.5 0 3 2.2 +1Score > 19 indicates identity ADCLNNVLDAITQFER + Deamidated (NQ)
2925 429.2297 1284.6673 1284.6786 -8.80 1 3 2.2 +1Score > 19 indicates identity INGEIRAQEVR + Deamidated (NQ)
2081 324.1737 646.3328 646.3398 -10.8 1 3 2.2 +1Score > 19 indicates identity NAGKTR + Deamidated (NQ)
4148 758.7358 2273.1856 2273.1573 12.4 1 3 1.5 +1Score > 17 indicates identity INKDDIVINDIAVSLSNICR + 2 Deamidated (NQ)
2003 543.3629 542.3556 542.3540 2.99 0 3 2.3 +1Score > 19 indicates identity AAIIR
2117 670.4249 669.4176 669.4173 0.42 0 3 0.55 +1Score > 13 indicates identity ATPLIR
2940 431.2294 1290.6664 1290.6642 1.67 0 3 2.5 +1Score > 19 indicates identity LGQGPGLMLFDK + Oxidation (M)
3124 345.9418 1379.7381 1379.7483 -7.38 0 2 1.2 +1Score > 16 indicates identity IIFCGTLTAGSLK
2752 596.3547 1190.6948 1190.7135 -15.7 0 2 0.57 +1Score > 13 indicates identity VALATTHLPLR
4068 690.9865 2069.9377 2069.9728 -17.0 1 2 1.8 +1Score > 17 indicates identity VATNLARNMVTQWGFSEK + 3 Deamidated (NQ); Oxidation (M)
3275 728.3678 1454.7210 1454.7412 -13.9 1 2 2.2 +1Score > 18 indicates identity GALQQEMTRIHR + Oxidation (M)
2959 434.8768 1301.6086 1301.6285 -15.3 0 2 1.4 +1Score > 16 indicates identity GQSIDDMIPAQK
4295 642.8259 2567.2745 2567.3119 -14.6 1 2 2.9 +1Score > 20 indicates identity TVDPLAGSYYIESLTDQIVKQAR + Deamidated (NQ)
2655 543.8011 1085.5876 1085.6015 -12.8 1 2 2.5 +1Score > 19 indicates identity QVLNMPTKR
4019 680.0150 2037.0232 2037.0275 -2.10 0 2 2.8 +1Score > 19 indicates identity MQTVMQTLLPYLNQALR + 2 Deamidated (NQ); Oxidation (M)
3543 579.9857 1736.9353 1736.9097 14.7 1 2 1.4 +1Score > 16 indicates identity QPVYQLYTLLNRAR + 3 Deamidated (NQ)
3542 579.9849 1736.9329 1736.9097 13.4 1 2 1.6 +1Score > 17 indicates identity QPVYQLYTLLNRAR + 3 Deamidated (NQ)
3285 733.3430 1464.6714 1464.6692 1.53 0 2 1.7 +1Score > 17 indicates identity GTSEISAGNADLSSR + Deamidated (NQ)
3835 640.0194 1917.0364 1917.0095 14.0 1 2 1 +1Score > 15 indicates identity QADGEKVIQVPIDLYTK + Deamidated (NQ)
4323 868.7676 2603.2810 2603.2901 -3.51 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 GEEGLFDLLRELGPMTVEDLAQR + Oxidation (M)
3536 868.9828 1735.9510 1735.9468 2.43 1 2 1.3 +1Score > 16 indicates identity IVTEEVVVKNHNAVGK + Deamidated (NQ)
2740 395.8606 1184.5600 1184.5422 15.0 0 2 1.8 +1Score > 17 indicates identity GDQAPDADQLR
4527 1160.0759 4636.2745 4636.2386 7.73 1 2 1.9 +1Score > 17 indicates identity QTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQR + 5 Deamidated (NQ); 3 Oxidation (M)
3573 584.6444 1750.9114 1750.9002 6.36 0 2 2 +1Score > 18 indicates identity VNNFQVSAASTPFLTR
2550 508.7555 1015.4964 1015.5046 -8.04 1 2 1.9 +1Score > 17 indicates identity RANAQAAANK + 2 Deamidated (NQ)
3442 831.4324 1660.8502 1660.8283 13.2 1 2 3 +1Score > 19 indicates identity AMWPSTAKWLNDLK + Deamidated (NQ)
4240 828.4377 2482.2913 2482.3155 -9.75 1 2 2.2 +1Score > 18 indicates identity LQEMVADVSHHFPLRLPAPTPK
4066 517.9933 2067.9441 2067.9639 -9.58 0 2 2.2 +1Score > 18 indicates identity SMVGISTDVMIVNCGSIPR + Deamidated (NQ); 2 Oxidation (M)
3000 662.3546 1322.6946 1322.7055 -8.17 1 2 1.9 +1Score > 17 indicates identity ALAALHDTARER
2885 635.8515 1269.6884 1269.7115 -18.1 0 2 2.3 +1Score > 18 indicates identity ISLPTPIMSGVR
4431 591.8934 2954.4306 2954.4495 -6.40 1 2 2.9 +1Score > 19 indicates identity TFATQKVSLEESVLSQVTTAIQNAQEK + 5 Deamidated (NQ)
3426 548.2925 1641.8557 1641.8695 -8.40 1 2 2.5 +1Score > 18 indicates identity VIGHSMQNCVLKLK + Oxidation (M)
4225 611.5715 2442.2569 2442.2556 0.51 1 2 2.2 +1Score > 18 indicates identity TIGYGESYINATGLRHVWHLR
4012 407.2054 2030.9906 2030.9909 -0.14 1 2 3.1 +1Score > 19 indicates identity AVTDSDEPPVVRYDVQNK
2490 985.4755 984.4682 984.4665 1.78 0 2 1.4 +1Score > 16 indicates identity GTYPAYSAR
3048 451.2233 1350.6481 1350.6602 -8.96 0 2 2.3 +1Score > 18 indicates identity NNVLSGLFCGLR + 2 Deamidated (NQ)
3203 356.1979 1420.7625 1420.7827 -14.2 1 2 1.6 +1Score > 16 indicates identity IKYPFLLSNGNR
2024 573.2634 572.2561 572.2554 1.24 0 2 0.67 +1Score > 13 indicates identity ADPNR + Deamidated (NQ)
3194 471.5835 1411.7287 1411.7203 5.91 1 2 1.9 +1Score > 17 indicates identity MIFMKNIGDALK + 2 Oxidation (M)
3137 347.4261 1385.6753 1385.6609 10.4 0 2 3.3 +1Score > 19 indicates identity AEEPALNMLADGR
3540 435.2396 1736.9293 1736.9097 11.3 1 2 1.8 +1Score > 17 indicates identity AFKDIGFDSLAGVELR
3748 617.0163 1848.0271 1847.9928 18.6 1 2 1.2 +1Score > 15 indicates identity MELIFLGTSAGVPTRTR
2632 537.2549 1072.4952 1072.4938 1.39 1 2 1.2 +1Score > 15 indicates identity KDFNSYGSR
2942 647.3210 1292.6274 1292.6282 -0.60 0 1 3.1 +1Score > 19 indicates identity GMVIGASEGTEVK + Oxidation (M)
3998 1012.5323 2023.0500 2023.0561 -2.97 1 1 2.4 +1Score > 18 indicates identity MTIIAGLPVEYNDRFIR + Oxidation (M)
3080 341.9435 1363.7449 1363.7473 -1.76 1 1 0.96 +1Score > 14 indicates identity FRHGIAIAGTHGK
4342 658.3156 2629.2333 2629.2806 -18.0 1 1 3.1 +1Score > 19 indicates identity NIDSIPAETLRTLSNMEWPGNVR + Deamidated (NQ); Oxidation (M)
2694 567.3040 1132.5934 1132.5911 2.10 0 1 2.6 +1Score > 18 indicates identity DGAGVLVVMTR + Oxidation (M)
4256 837.0828 2508.2266 2508.2108 6.31 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VLGDAVFDDHNVFRAEFDIAMK
3254 721.8611 1441.7076 1441.7201 -8.65 0 1 1.7 +1Score > 16 indicates identity FHAQPLSANDTLK + Deamidated (NQ)
4506 925.9566 3699.7973 3699.8469 -13.4 1 1 3.3 +1Score > 19 indicates identity LIRQEAGMVFQQFYLFPHLTALENVMFGPLR + 3 Deamidated (NQ); 2 Oxidation (M)
3325 752.3156 1502.6166 1502.6426 -17.3 0 1 0.74 +1Score > 13 indicates identity AWFAENPQGNDPR + 2 Deamidated (NQ)
4015 678.6717 2032.9933 2032.9921 0.56 1 1 3.5 +1Score > 19 indicates identity KVVIVGCGAQGLNQGLNMR + 4 Deamidated (NQ); Oxidation (M)
2801 613.8123 1225.6100 1225.5873 18.5 1 1 2.4 +1Score > 17 indicates identity ARTLGMYNSGR + Deamidated (NQ)
3949 667.7438 2000.2096 2000.1863 11.6 0 1 0.75 +1Score > 13 indicates identity NSFFIGLLPVLLVLWIR + Deamidated (NQ)
3470 564.3026 1689.8860 1689.8937 -4.60 1 1 3.2 +1Score > 19 indicates identity IFVASIRGDVQQQVK + 3 Deamidated (NQ)
2724 582.3261 1162.6376 1162.6346 2.64 1 1 1.8 +1Score > 16 indicates identity GLAYIKVNER + Deamidated (NQ)
4216 812.4262 2434.2568 2434.2816 -10.2 1 1 2.9 +1Score > 18 indicates identity QDILEAIRDHQVVIVAGETGSGK
4250 834.7533 2501.2381 2501.2334 1.85 0 1 3.7 +1Score > 19 indicates identity LDIDFTFACEAEMLIFQLGLR
3897 653.6769 1958.0089 1957.9844 12.5 0 1 3.2 +1Score > 19 indicates identity ASVIDTATNAAPGTILEANK + 2 Deamidated (NQ)
2838 624.2994 1246.5842 1246.5612 18.5 0 1 2.6 +1Score > 18 indicates identity MNPETNSIANR + Deamidated (NQ)
2479 491.2016 980.3886 980.4055 -17.2 0 1 0.78 +1Score > 13 indicates identity MEMTNAQR + Deamidated (NQ)
2804 409.8770 1226.6092 1226.6077 1.17 0 1 2.7 +1Score > 18 indicates identity AQIIGGMEHVR + Deamidated (NQ); Oxidation (M)
3639 445.9864 1779.9165 1779.9229 -3.61 0 1 2.6 +1Score > 18 indicates identity LFELMQGFDAEVLLR
4155 768.4189 2302.2349 2302.2354 -0.25 1 1 2.1 +1Score > 17 indicates identity MPLSAQQLAAQKNLSYVLAEK
3062 454.5807 1360.7203 1360.7021 13.4 0 1 3.7 +1Score > 19 indicates identity DSGSDMVLVGLLR
Page: Previous 1 2 3 4 5 6 7 8 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/