MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1249__2.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:45:54 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,602

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4272)


Page: Previous 1 2 3 4 5 6 7  43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2144 342.6855 683.3564 683.3463 14.9 1 7 0.25 +1Score > 13 indicates identity HESRR
3020 669.3570 1336.6994 1336.7099 -7.80 1 7 0.89 +1Score > 19 indicates identity SPSAQKLEALHR + Deamidated (NQ)
3176 702.8515 1403.6884 1403.6867 1.24 0 7 0.96 +1Score > 19 indicates identity GISDLAQHYLMR + Deamidated (NQ)
3791 471.4737 1881.8657 1881.8639 0.97 1 7 0.89 +1Score > 19 indicates identity ADCEQLAELRSHAPER + Deamidated (NQ)
2454 479.2631 956.5116 956.5291 -18.2 0 6 1 +1Score > 19 indicates identity QDILEAIR
3575 438.7355 1750.9129 1750.9101 1.61 0 6 0.76 +1Score > 18 indicates identity LAEPAPTGEQLQNILR + 2 Deamidated (NQ)
2366 457.2010 912.3874 912.3937 -6.84 0 6 0.23 +1Score > 13 indicates identity DQLNHQR + 3 Deamidated (NQ)
4239 827.7393 2480.1961 2480.1828 5.36 1 6 0.94 +1Score > 19 indicates identity AMRLLVPPAWQNNPDMDPELR + 2 Deamidated (NQ); Oxidation (M)
4106 534.0483 2132.1641 2132.1266 17.6 1 6 0.41 +1Score > 15 indicates identity ESIQIFHNPRVLVEPEPK + Deamidated (NQ)
3140 347.9352 1387.7117 1387.6983 9.63 0 6 1.1 +1Score > 19 indicates identity QQNVPVFLLGDR + 3 Deamidated (NQ)
2104 332.6746 663.3346 663.3374 -4.11 0 6 1.2 +1Score > 20 indicates identity AALSMR + Oxidation (M)
2200 720.4066 719.3993 719.3966 3.78 0 6 0.69 +1Score > 17 indicates identity ALPTYR
3039 337.4402 1345.7317 1345.7282 2.62 0 6 0.67 +1Score > 17 indicates identity GEYLPIVELWK
3579 438.7370 1750.9189 1750.9254 -3.70 1 6 0.77 +1Score > 17 indicates identity AFKDLGFDSLAAVELR
2828 621.2905 1240.5664 1240.5870 -16.5 1 6 0.57 +1Score > 16 indicates identity NSYMGRLINR + 2 Deamidated (NQ); Oxidation (M)
2867 629.3173 1256.6200 1256.6010 15.1 0 6 0.81 +1Score > 18 indicates identity LAEHGATEHHR
3200 710.8478 1419.6810 1419.6590 15.6 1 6 1 +1Score > 19 indicates identity SVSRLGNSEQQGR + 3 Deamidated (NQ)
4069 518.7434 2070.9445 2070.9106 16.4 0 6 0.86 +1Score > 18 indicates identity CVVVVDHYDWEDDAPPR
2132 338.6754 675.3362 675.3261 15.0 0 6 1.1 +1Score > 19 indicates identity AMAELAA
3979 670.6836 2009.0290 2009.0079 10.5 1 6 1.2 +1Score > 19 indicates identity RWLESQGVDVANGSNHLK
2279 411.7290 821.4434 821.4508 -8.90 1 6 0.7 +1Score > 17 indicates identity QRLSYR
3116 345.4383 1377.7241 1377.7252 -0.79 0 6 0.94 +1Score > 18 indicates identity KPDHQLAALQEK + Deamidated (NQ)
3501 857.9945 1713.9744 1713.9625 6.98 1 6 0.3 +1Score > 13 indicates identity GVELLSTGGTARLLAEK
2282 822.4549 821.4476 821.4508 -3.82 1 6 0.45 +1Score > 15 indicates identity QRLSYR
2982 439.2336 1314.6790 1314.6932 -10.8 0 6 1.2 +1Score > 19 indicates identity AQNHLYTVLEK
2467 324.1748 969.5026 969.4920 10.9 1 6 0.64 +1Score > 16 indicates identity IRDYFQK + Deamidated (NQ)
3150 464.9209 1391.7409 1391.7482 -5.30 1 6 0.83 +1Score > 17 indicates identity QLALFKEMQGVK + Deamidated (NQ)
2401 930.5268 929.5195 929.5182 1.45 0 6 1 +1Score > 18 indicates identity IITQADLR + Deamidated (NQ)
2545 338.1864 1011.5374 1011.5284 8.92 1 6 0.43 +1Score > 14 indicates identity MLQKHAER
2619 532.7538 1063.4930 1063.4968 -3.51 1 6 0.75 +1Score > 17 indicates identity TAIDMDKNR + Deamidated (NQ)
3896 980.0093 1958.0040 1958.0295 -13.0 1 5 1.2 +1Score > 19 indicates identity NLTILDMFGPPKTNAGIR + Deamidated (NQ)
2325 440.2341 878.4536 878.4610 -8.37 1 5 0.98 +1Score > 18 indicates identity PSTRYQK
4531 927.7491 5560.4509 5560.5454 -17.0 1 5 0.29 +1Score > 13 indicates identity APGSSSSGANGDGSLAQSQTGAVVRATNAASDFTLLELNTAANPAYNLFWAGWDR + 6 Deamidated (NQ)
2564 513.7325 1025.4504 1025.4600 -9.32 0 5 0.45 +1Score > 14 indicates identity ISQYACQR + Deamidated (NQ)
4415 978.4999 2932.4779 2932.4964 -6.31 1 5 1.1 +1Score > 18 indicates identity FNGKPASGLGVKLASGANEMATAELVLNR + 2 Deamidated (NQ); Oxidation (M)
3129 461.9169 1382.7289 1382.7228 4.42 1 5 1 +1Score > 18 indicates identity LAMQSVRSLFSK + Deamidated (NQ); Oxidation (M)
2797 613.2822 1224.5498 1224.5371 10.4 0 5 0.59 +1Score > 16 indicates identity TDQYGGSVENR
3118 460.2490 1377.7252 1377.7041 15.3 0 5 1.1 +1Score > 18 indicates identity FPYVNANVIDAR
2853 628.3252 1254.6358 1254.6431 -5.75 1 5 0.94 +1Score > 17 indicates identity FMTFISPEKR
4221 488.8435 2439.1811 2439.2250 -18.0 1 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
SNIGHPQGAAGVAGVIKMVMALQR + 3 Deamidated (NQ); 2 Oxidation (M)
2295 418.2053 834.3960 834.4018 -6.85 1 5 0.83 +1Score > 17 indicates identity SAMDKGAR
2418 471.7764 941.5382 941.5406 -2.52 1 5 0.67 +1Score > 16 indicates identity IALAENRR
2733 393.5224 1177.5454 1177.5615 -13.7 0 5 1.1 +1Score > 18 indicates identity VLQEQEFER + Deamidated (NQ)
2515 331.8262 992.4568 992.4597 -2.94 0 5 0.7 +1Score > 16 indicates identity MATTVEADR
3034 671.8710 1341.7274 1341.7153 9.04 0 5 1.6 +1Score > 19 indicates identity LLADPHLGHVNR + Deamidated (NQ)
3877 488.2453 1948.9521 1948.9676 -7.97 0 5 0.96 +1Score > 20 indicates identity
Score > 17 indicates homology
MLAQSLQALEQDGFLNR + Oxidation (M)
3248 478.5898 1432.7476 1432.7424 3.58 0 5 1.5 +1Score > 19 indicates identity IWFIPAMPETTK
2192 718.3281 717.3208 717.3293 -11.8 0 5 0.62 +1Score > 15 indicates identity VEGEER
4196 803.7543 2408.2411 2408.2547 -5.65 1 5 1.4 +1Score > 19 indicates identity NLKLALTAGIGSDHVDLQSAIDR + 2 Deamidated (NQ)
3142 694.8682 1387.7218 1387.6943 19.9 1 5 1.5 +1Score > 19 indicates identity AIDSSPDKANLTR + Deamidated (NQ)
2525 502.2526 1002.4906 1002.4730 17.6 0 5 1.5 +1Score > 19 indicates identity NESAGEQLR
3478 565.9914 1694.9524 1694.9679 -9.14 0 5 0.51 +1Score > 14 indicates identity LLANRPESALAVTLAR + Deamidated (NQ)
3809 633.6198 1897.8376 1897.8186 10.0 0 5 0.86 +1Score > 17 indicates identity SCAFLIADGVMPSNENR + 2 Deamidated (NQ); Oxidation (M)
4530 1112.8981 5559.4541 5559.5031 -8.80 1 5 0.34 +1Score > 13 indicates identity AFYSMGGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFNAETVKMFTTSSK + 5 Deamidated (NQ); 3 Oxidation (M)
3177 351.9294 1403.6885 1403.7005 -8.52 1 5 1.5 +1Score > 19 indicates identity RSETETVADALGR
2281 822.4536 821.4463 821.4508 -5.40 1 5 0.58 +1Score > 15 indicates identity QRLSYR
4380 924.1334 2769.3784 2769.4218 -15.7 0 5 1.6 +1Score > 19 indicates identity IMDLQSAQQLGEIAAAVGLAQNLGALR + 3 Deamidated (NQ); Oxidation (M)
2887 636.3586 1270.7026 1270.6881 11.5 1 5 1.2 +1Score > 18 indicates identity DGKINLLDLNR + Deamidated (NQ)
3868 646.9586 1937.8540 1937.8789 -12.9 0 5 0.7 +1Score > 16 indicates identity LPSTCFAEENGSIVNSGR + Deamidated (NQ)
3414 818.4063 1634.7980 1634.7934 2.86 1 4 1.8 +1Score > 19 indicates identity SANMIDRDTLDALGK + Oxidation (M)
4211 607.0618 2424.2181 2424.2145 1.47 1 4 1.8 +1Score > 19 indicates identity SHGAANQRAFAVAIEQAVQAVQR + 3 Deamidated (NQ)
2712 577.2811 1152.5476 1152.5267 18.2 1 4 1.2 +1Score > 18 indicates identity MLQRMDSEK + Oxidation (M)
2684 561.8037 1121.5928 1121.5829 8.86 1 4 1.4 +1Score > 18 indicates identity GSAFTQEVKR
3580 584.6470 1750.9192 1750.9002 10.8 0 4 1.2 +1Score > 17 indicates identity VNNFQVSAASTPFLTR
3623 590.6443 1768.9111 1768.9206 -5.41 1 4 1.5 +1Score > 18 indicates identity ALDVATNVLQRNPNIK + 4 Deamidated (NQ)
2419 471.7767 941.5388 941.5406 -1.88 1 4 0.79 +1Score > 16 indicates identity IALAENRR
4340 658.3148 2629.2301 2629.2368 -2.56 1 4 1.6 +1Score > 19 indicates identity TTEQSWQQQTRTSQAAPVQAQPR + 3 Deamidated (NQ)
2870 420.8715 1259.5927 1259.5854 5.76 1 4 0.99 +1Score > 17 indicates identity GDASGDALNRQR + Deamidated (NQ)
3980 670.6840 2009.0302 2008.9966 16.7 0 4 1.7 +1Score > 19 indicates identity ASNGLNIHLNHYESLLGR + 2 Deamidated (NQ)
2964 327.1675 1304.6409 1304.6361 3.69 0 4 1.5 +1Score > 18 indicates identity WQSTSVNDVLR + Deamidated (NQ)
3041 337.4408 1345.7341 1345.7606 -19.7 1 4 1.1 +1Score > 17 indicates identity VYPLTVGDKVQK
3519 864.4838 1726.9530 1726.9577 -2.70 1 4 1 +1Score > 17 indicates identity LNALEGKLQTGEISVR
2824 621.2666 1240.5186 1240.5207 -1.68 0 4 0.4 +1Score > 13 indicates identity TEQQYENATR + 2 Deamidated (NQ)
2881 634.3641 1266.7136 1266.6932 16.1 0 4 0.46 +1Score > 13 indicates identity TPVALLDAPASGR
2781 606.8049 1211.5952 1211.6186 -19.3 0 4 1.5 +1Score > 18 indicates identity QLGVSYFLER + Deamidated (NQ)
3601 878.9440 1755.8734 1755.9050 -18.0 1 4 1.8 +1Score > 19 indicates identity VQQGRLVVNGASMPQR + Deamidated (NQ); Oxidation (M)
3044 337.4412 1345.7357 1345.7136 16.4 1 4 1.1 +1Score > 17 indicates identity MSELIVSRQQR
2287 414.2058 826.3970 826.3933 4.54 1 4 0.92 +1Score > 16 indicates identity EKHQQR + 2 Deamidated (NQ)
2343 893.4508 892.4435 892.4403 3.66 1 4 1.3 +1Score > 18 indicates identity AAFEDKGR
2741 395.8608 1184.5606 1184.5397 17.6 0 4 1.2 +1Score > 17 indicates identity HCVWEEVAR
3125 345.9425 1379.7409 1379.7483 -5.35 0 4 0.86 +1Score > 16 indicates identity IIFCGTLTAGSLK
3872 485.9830 1939.9029 1939.9244 -11.1 0 4 1.2 +1Score > 17 indicates identity HLQQMQHSLGMTVGTVR + 2 Deamidated (NQ); Oxidation (M)
2178 354.1964 706.3782 706.3796 -1.88 1 4 1.1 +1Score > 17 indicates identity LRSGMK + Oxidation (M)
3611 881.4874 1760.9602 1760.9308 16.7 1 4 1.1 +1Score > 17 indicates identity LLQDADVFITNVREK + Deamidated (NQ)
4076 695.0237 2082.0493 2082.0527 -1.66 1 4 1.9 +1Score > 19 indicates identity MNSIEQALKIAEQHNISR + Deamidated (NQ)
2661 548.7223 1095.4300 1095.4469 -15.4 1 4 0.41 +1Score > 13 indicates identity DFEDKDDGR
4361 895.4604 2683.3594 2683.3470 4.60 0 4 1.6 +1Score > 18 indicates identity ALAQAMHQAGKPLGFMCIAPAMLPK + 2 Oxidation (M)
4251 835.0648 2502.1726 2502.2060 -13.4 0 4 1.7 +1Score > 19 indicates identity SIIPSGYGVNPEGPTQECLSALGR + Deamidated (NQ)
2280 822.4517 821.4444 821.4508 -7.71 1 4 1.1 +1Score > 17 indicates identity QRLSYR
2358 302.8324 905.4754 905.4607 16.2 0 4 2 +1Score > 19 indicates identity QAGKPYDK
2002 543.3621 542.3548 542.3540 1.51 0 4 1.8 +1Score > 19 indicates identity AAIIR
2317 435.7578 869.5010 869.5083 -8.31 1 4 0.64 +1Score > 14 indicates identity ERLLSPR
4014 509.0045 2031.9889 2031.9709 8.88 1 4 0.54 +1Score > 20 indicates identity
Score > 13 indicates homology
AEPTSGGGQLSTAQKQNISR + 3 Deamidated (NQ)
3156 465.5809 1393.7209 1393.7388 -12.8 1 4 1.5 +1Score > 18 indicates identity LGERSCAYVVLK
3447 555.9594 1664.8564 1664.8774 -12.6 1 4 1.9 +1Score > 19 indicates identity AQVAIFKEIFDQVR + 2 Deamidated (NQ)
2372 459.7207 917.4268 917.4202 7.20 1 3 1.3 +1Score > 17 indicates identity EANEGDKR
4070 519.7497 2074.9697 2075.0106 -19.7 1 3 1.7 +1Score > 18 indicates identity RVGETAWAQDTIADCLLR + Deamidated (NQ)
2390 310.1582 927.4528 927.4661 -14.4 0 3 0.8 +1Score > 15 indicates identity GLLPENER + Deamidated (NQ)
3991 673.6527 2017.9363 2017.9626 -13.1 0 3 1.6 +1Score > 18 indicates identity IDVSQVDVSMNGIELQDR + Deamidated (NQ)
3999 675.3585 2023.0537 2023.0442 4.67 1 3 1.5 +1Score > 18 indicates identity VMAGLGIAVVSTSKGVMTDR + 2 Oxidation (M)
Page: Previous 1 2 3 4 5 6 7  43 Next 

Not what you expected? Try the select summary.