MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1249__2.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:45:54 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,602

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 4272)


Page: 1 2 3 4 5 6  43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2275 408.7212 815.4278 815.4137 17.3 0 19 0.068 +1Score > 20 indicates identity QVGDLER
3360 775.4008 1548.7870 1548.7784 5.60 0 17 0.09 +1Score > 19 indicates identity GATVELADGVEGYLR
3309 495.5904 1483.7494 1483.7518 -1.65 1 17 0.08 -1Score > 18 indicates identity ISNVPVPEDKQTR + 2 Deamidated (NQ)
1936 475.2630 474.2557 474.2550 1.45 0 16 0.074 +1Score > 18 indicates identity TGAAR
1935 475.2267 474.2194 474.2187 1.62 0 16 0.065 +1Score > 17 indicates identity DGAGR
3170 349.9414 1395.7365 1395.7358 0.52 1 16 0.07 +1Score > 17 indicates identity THDNKLQVEAIK + Deamidated (NQ)
3162 349.9403 1395.7321 1395.7358 -2.63 1 15 0.08 +1Score > 17 indicates identity THDNKLQVEAIK + Deamidated (NQ)
2082 647.3411 646.3338 646.3286 8.13 1 15 0.12 +1Score > 19 indicates identity KENEK
2354 904.4541 903.4468 903.4298 18.9 0 15 0.16 +1Score > 19 indicates identity SDAELVDR
2429 473.7434 945.4722 945.4590 14.1 0 15 0.14 +1Score > 19 indicates identity IPQQGMVR + 2 Deamidated (NQ); Oxidation (M)
2133 338.6758 675.3370 675.3374 -0.48 0 14 0.14 +1Score > 18 indicates identity MAGLER
2006 547.3043 546.2970 546.2948 4.10 0 14 0.27 +1Score > 21 indicates identity AMIGR
2431 473.7452 945.4758 945.4590 17.9 0 14 0.17 +1Score > 19 indicates identity IPQQGMVR + 2 Deamidated (NQ); Oxidation (M)
1992 536.2745 535.2672 535.2754 -15.3 0 14 0.14 +1Score > 18 indicates identity GAFNK
3459 419.7180 1674.8429 1674.8631 -12.0 0 14 0.22 +1Score > 19 indicates identity SVDYTVWIHRPFR
3042 337.4408 1345.7341 1345.7606 -19.7 1 13 0.12 +1Score > 17 indicates identity VYPLTVGDKVQK
2056 630.3578 629.3505 629.3497 1.36 0 13 0.32 +1Score > 21 indicates identity DIVQR
2182 710.3667 709.3594 709.3581 1.83 0 13 0.1 +1Score > 16 indicates identity MGFALR + Oxidation (M)
2033 590.2895 589.2822 589.2820 0.44 0 13 0.19 +1Score > 18 indicates identity EGSAAR
4103 710.3696 2128.0870 2128.0722 6.94 0 13 0.24 +1Score > 19 indicates identity VVNVGDVVEVMVLDIDEER
2193 359.6679 717.3212 717.3293 -11.2 0 13 0.1 +1Score > 15 indicates identity ENDAIR + Deamidated (NQ)
2748 595.3220 1188.6294 1188.6251 3.65 0 13 0.22 +1Score > 19 indicates identity ANPNIGVSVYR
2239 760.4210 759.4137 759.4173 -4.77 1 13 0.27 +1Score > 20 indicates identity
Score > 20 indicates homology
RMANLR
2319 437.2455 872.4764 872.4715 5.64 1 13 0.26 +1Score > 19 indicates identity AANKLAQR + 2 Deamidated (NQ)
3163 349.9404 1395.7325 1395.7358 -2.34 1 13 0.15 +1Score > 17 indicates identity THDNKLQVEAIK + Deamidated (NQ)
1960 503.2589 502.2516 502.2500 3.33 0 12 0.27 +1Score > 19 indicates identity SSGPR
2130 675.3442 674.3369 674.3460 -13.4 1 12 0.32 +1Score > 20 indicates identity SREQR
2369 457.7819 913.5492 913.5345 16.2 1 12 0.19 +1Score > 18 indicates identity KQQIQLR + Deamidated (NQ)
2160 346.7143 691.4140 691.4017 17.8 0 12 0.14 +1Score > 16 indicates identity AFVVTR
2330 442.7447 883.4748 883.4875 -14.4 0 12 0.12 +1Score > 15 indicates identity LSPVNQAR
2183 710.3677 709.3604 709.3581 3.24 0 12 0.13 +1Score > 16 indicates identity MGFALR + Oxidation (M)
3598 878.4432 1754.8718 1754.8801 -4.67 0 12 0.23 +1Score > 18 indicates identity QSVFLYQLAVQTMPK + 3 Deamidated (NQ)
2261 397.2393 792.4640 792.4606 4.35 1 12 0.12 +1Score > 15 indicates identity SLRVYR
2298 842.4020 841.3947 841.3977 -3.54 1 12 0.14 +1Score > 16 indicates identity DVCHRR
1978 529.2745 528.2672 528.2656 3.09 0 11 0.073 +1Score > 13 indicates identity AGPQR + Deamidated (NQ)
2166 349.6516 697.2886 697.2887 -0.11 0 11 0.073 +1Score > 13 indicates identity MTAMGR + 2 Oxidation (M)
2704 572.3228 1142.6310 1142.6295 1.35 0 11 0.22 +1Score > 17 indicates identity VNLIASQIQR + 2 Deamidated (NQ)
3198 474.2263 1419.6571 1419.6816 -17.3 0 11 0.26 +1Score > 18 indicates identity EMNVQFPAQTVR + Deamidated (NQ)
2238 760.3268 759.3195 759.3334 -18.2 0 11 0.078 +1Score > 13 indicates identity HMTAER + Oxidation (M)
3157 697.8737 1393.7328 1393.7565 -17.0 1 11 0.24 +1Score > 17 indicates identity GAVPDAVADPNLKK
2305 855.4653 854.4580 854.4610 -3.48 0 11 0.088 +1Score > 13 indicates identity NLAEGVPR
2630 535.7621 1069.5096 1069.5001 8.91 0 11 0.17 +1Score > 16 indicates identity LYELEMQK + Deamidated (NQ); Oxidation (M)
2792 610.8049 1219.5952 1219.5833 9.79 0 11 0.33 +1Score > 18 indicates identity GQGQVEQVFAR + 2 Deamidated (NQ)
2329 442.7436 883.4726 883.4763 -4.12 0 11 0.16 +1Score > 15 indicates identity EALNLPAR + Deamidated (NQ)
2978 657.3621 1312.7096 1312.7099 -0.17 1 11 0.26 +1Score > 17 indicates identity QARLDAAAQLEK
2689 375.5190 1123.5352 1123.5332 1.77 0 11 0.24 +1Score > 17 indicates identity GDEFAVLMSR
1991 531.3154 530.3081 530.3064 3.29 0 10 1 +1Score > 23 indicates identity
Score > 23 indicates homology
AELAK
2353 451.7811 901.5476 901.5345 14.6 1 10 0.092 +1Score > 13 indicates identity SKSALLQR
3576 584.6450 1750.9132 1750.9002 7.39 0 10 0.32 +1Score > 18 indicates identity VNNFQVSAASTPFLTR
2535 505.7469 1009.4792 1009.4651 14.0 0 10 0.2 +1Score > 16 indicates identity GMVFEQQR + Oxidation (M)
3135 692.7868 1383.5590 1383.5370 16.0 0 10 0.098 +1Score > 13 indicates identity NWQLACECMR + Deamidated (NQ); Oxidation (M)
2308 428.7682 855.5218 855.5178 4.74 0 10 0.2 +1Score > 16 indicates identity LASVLTPR
2211 364.7443 727.4740 727.4704 4.98 1 10 0.1 +1Score > 13 indicates identity QLIARK
3024 447.2153 1338.6241 1338.6350 -8.18 1 10 0.3 +1Score > 17 indicates identity KDSGFQMNQLR + Oxidation (M)
2158 692.3392 691.3319 691.3323 -0.53 0 10 0.4 +1Score > 18 indicates identity MAGLER + Oxidation (M)
3923 661.3384 1980.9934 1980.9682 12.7 1 10 0.46 +1Score > 19 indicates identity MTMNITSKQMEITPAIR + Deamidated (NQ); Oxidation (M)
2159 346.7037 691.3928 691.3905 3.46 0 10 0.29 +1Score > 17 indicates identity FINGLK + Deamidated (NQ)
2518 332.1572 993.4498 993.4628 -13.1 1 10 0.25 +1Score > 16 indicates identity NRNFQASR + 2 Deamidated (NQ)
1969 515.3323 514.3250 514.3227 4.47 0 10 0.95 +1Score > 22 indicates identity GAIVR
3864 968.9330 1935.8514 1935.8785 -14.0 0 9 0.25 +1Score > 16 indicates identity DEAHNVMSNLYYPEVR
2477 326.5006 976.4800 976.4865 -6.71 0 9 0.58 +1Score > 19 indicates identity NPNLLDYK + Deamidated (NQ)
2629 535.7612 1069.5078 1069.5114 -3.31 0 9 0.23 +1Score > 15 indicates identity NFITGMATAK + Deamidated (NQ); Oxidation (M)
3922 991.5028 1980.9910 1980.9682 11.5 1 9 0.53 +1Score > 19 indicates identity MTMNITSKQMEITPAIR + Deamidated (NQ); Oxidation (M)
2462 323.1602 966.4588 966.4406 18.8 0 9 0.35 +1Score > 17 indicates identity AAFENSATR + Deamidated (NQ)
2256 392.2462 782.4778 782.4650 16.4 0 9 0.16 +1Score > 13 indicates identity VLLDPAR
2859 419.8369 1256.4889 1256.4728 12.8 0 9 0.12 +1Score > 13 indicates identity GDYTCGGQDQR + Deamidated (NQ)
2434 317.8344 950.4814 950.4644 17.9 1 9 0.43 +1Score > 18 indicates identity KGMFAPER + Oxidation (M)
2276 409.2021 816.3896 816.3838 7.18 1 9 0.34 +1Score > 17 indicates identity QNRNAGR + 2 Deamidated (NQ)
2237 380.2230 758.4314 758.4286 3.73 0 9 0.21 +1Score > 21 indicates identity
Score > 15 indicates homology
LAAQLSR + Deamidated (NQ)
2134 338.6758 675.3370 675.3486 -17.1 1 9 0.51 +1Score > 18 indicates identity RVMDR
2884 424.2355 1269.6847 1269.6928 -6.41 0 9 0.47 +1Score > 18 indicates identity ENIILALQAQR + 2 Deamidated (NQ)
2534 337.4973 1009.4701 1009.4651 4.91 0 9 0.35 +1Score > 16 indicates identity GMVFEQQR + Oxidation (M)
2866 629.3167 1256.6188 1256.6010 14.2 0 9 0.47 +1Score > 18 indicates identity LAEHGATEHHR
2260 397.2384 792.4622 792.4606 2.08 1 9 0.25 +1Score > 15 indicates identity SLRVYR
2119 671.3502 670.3429 670.3511 -12.1 1 8 0.14 +1Score > 13 indicates identity APRDGR
2706 572.7751 1143.5356 1143.5421 -5.64 1 8 0.27 +1Score > 15 indicates identity HTTRNFPNR + 2 Deamidated (NQ)
2430 946.4814 945.4741 945.4590 16.0 0 8 0.68 +1Score > 19 indicates identity IPQQGMVR + 2 Deamidated (NQ); Oxidation (M)
2407 469.2430 936.4714 936.4552 17.3 0 8 0.4 +1Score > 17 indicates identity AGQELYQK + Deamidated (NQ)
2855 419.2446 1254.7120 1254.7118 0.13 0 8 0.27 +1Score > 15 indicates identity LPIAIQQAVMR + Oxidation (M)
3714 610.6485 1828.9237 1828.9319 -4.51 1 8 0.69 +1Score > 19 indicates identity QATEVALLVDHSKFDR + Deamidated (NQ)
2593 523.2686 1044.5226 1044.5200 2.58 1 8 0.61 +1Score > 19 indicates identity QDEQEIKR
2475 487.7425 973.4704 973.4539 17.0 0 8 0.65 +1Score > 19 indicates identity DPNEMLVR + Deamidated (NQ)
2808 615.8077 1229.6008 1229.5775 19.0 0 8 0.52 +1Score > 17 indicates identity VPQTEEELER + Deamidated (NQ)
2323 879.4594 878.4521 878.4531 -1.14 1 8 0.63 +1Score > 18 indicates identity MGSEISKK
2157 346.6730 691.3314 691.3323 -1.22 0 8 0.66 +1Score > 18 indicates identity MAGLER + Oxidation (M)
2167 350.2307 698.4468 698.4439 4.23 0 8 0.17 +1Score > 13 indicates identity IGLLAGR
1979 529.2750 528.2677 528.2656 4.03 0 8 0.17 +1Score > 13 indicates identity AGPQR + Deamidated (NQ)
3375 521.6011 1561.7815 1561.8100 -18.3 0 8 1 +1Score > 21 indicates identity
Score > 20 indicates homology
GGFIESEGGGTVLLAR
2344 447.7361 893.4576 893.4607 -3.39 0 8 0.74 +1Score > 19 indicates identity FEATATVR
1983 529.2757 528.2684 528.2656 5.36 0 8 0.18 +1Score > 13 indicates identity AGPQR + Deamidated (NQ)
2083 324.1753 646.3360 646.3286 11.6 1 7 0.88 +1Score > 19 indicates identity KENEK
2645 540.7373 1079.4600 1079.4706 -9.74 0 7 0.25 +1Score > 14 indicates identity MNQQLSWR + 2 Deamidated (NQ); Oxidation (M)
4498 1191.2216 3570.6430 3570.6252 4.98 1 7 0.61 +1Score > 18 indicates identity MCELLGMSANVPTDICFSFTGLVQRGGGTGPHK + 2 Deamidated (NQ); 2 Oxidation (M)
2143 684.3625 683.3552 683.3602 -7.30 0 7 0.26 +1Score > 14 indicates identity IPSNPR + Deamidated (NQ)
2705 572.7731 1143.5316 1143.5421 -9.14 1 7 0.34 +1Score > 15 indicates identity HTTRNFPNR + 2 Deamidated (NQ)
3274 727.8754 1453.7362 1453.7460 -6.68 1 7 0.61 +1Score > 17 indicates identity DLSHGMQRIEIR
4008 1016.0072 2029.9998 2030.0221 -11.0 1 7 1 +1Score > 19 indicates identity RDWQLQQLGITQWSLR + 3 Deamidated (NQ)
4222 610.8035 2439.1849 2439.2104 -10.5 0 7 1 +1Score > 20 indicates identity
Score > 19 indicates homology
FVQPGTQVYDLGCSLGAATLSVR + Deamidated (NQ)
2544 338.1844 1011.5314 1011.5324 -1.00 0 7 0.38 +1Score > 15 indicates identity AAMAWLPPR
2924 643.3397 1284.6648 1284.6786 -10.7 1 7 0.83 +1Score > 18 indicates identity AIAELVNGDARR + Deamidated (NQ)
Page: 1 2 3 4 5 6  43 Next 

Not what you expected? Try the select summary.