MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1249__2.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:45:54 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,602

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 40)


Page: 1 2 3 4 Next 

-1

Accession Score Description
Family member distances as a dendrogram 1 Q9EX54_STRCO 4547 Putative type I polyketide synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO6273 PE=4 SV=1
2 NARQ_ECOLI 33 description
3 A4U8R3_9BACT 23 SupA OS=Aplysina aerophoba bacterial symbiont clone pAPKS18 GN=supA PE=4 SV=1
Cut threshold

Score Mass Matches Sequences emPAI
Q9EX54_STRCO 4547 46170 190 (159) 41 (36) 76.41
Putative type I polyketide synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO6273 PE=4 SV=1
NARQ_ECOLI 33 0 4 (3) 1 (1) 0.11
description
A4U8R3_9BACT 23 362145 5 (3) 4 (2) 0.02
SupA OS=Aplysina aerophoba bacterial symbiont clone pAPKS18 GN=supA PE=4 SV=1

-198 peptide matches (79 non-duplicate, 119 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 3 Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 3 Peptide
2000 +1 541.3478 540.3405 540.3384 3.97 0 18 0.018 +1Score > 13 indicates identity U X R.GVPLR.V
2000 +1 541.3478 540.3405 540.3384 3.97 0 16 0.027 +2Score > 13 indicates identity U X R.GVIPR.H
2069 +1 642.4306 641.4233 641.4224 1.40 0 30 0.0015 +1Score > 14 indicates identity U X R.IIGIAR.D
2071 +5 321.7193 641.4240 641.4224 2.53 0 31 0.0012 +1Score > 14 indicates identity U X R.IIGIAR.D
2101 +1 330.6780 659.3414 659.3391 3.57 0 37 0.00098 +1Score > 19 indicates identity U X K.WVAER.I
2101 +1 330.6780 659.3414 659.3351 9.70 1 20 0.045 +3Score > 19 indicates identity U X R.ERAER.L
2103   660.3510 659.3437 659.3351 13.2 1 26 0.011 +1Score > 19 indicates identity U X R.ERAER.L
2103   660.3510 659.3437 659.3391 7.02 0 24 0.019 +2Score > 19 indicates identity U X K.WVAER.I
2108 +3 333.1804 664.3462 664.3432 4.63 0 25 0.007 +1Score > 16 indicates identity U X R.ELFEK.Y
2112 +1 665.3539 664.3466 664.3432 5.20 0 36 0.00052 +1Score > 16 indicates identity U X R.ELFEK.Y
2124   336.6891 671.3636 671.3602 5.09 0 7 0.42 +1Score > 16 indicates identity U X R.TQGPAAK.T
2165   349.2277 696.4408 696.4395 1.96 1 20 0.01 +1Score > 13 indicates identity U X R.RGVIPR.H
2168   350.7223 699.4300 699.4279 3.07 0 12 0.16 +3Score > 16 indicates identity U X R.VIEALR.K
2337   890.5123 889.5050 889.5022 3.23 0 35 0.00074 +1Score > 17 indicates identity U X R.GLPVSVYR.V
2339 +4 445.7603 889.5060 889.5022 4.38 0 39 0.00028 +1Score > 16 indicates identity U X R.GLPVSVYR.V
2394 +2 465.2632 928.5118 928.5090 3.08 1 34 0.0014 +1Score > 18 indicates identity U X R.LRENLER.Y
2395 +2 310.5113 928.5121 928.5090 3.32 1 38 0.00062 +1Score > 18 indicates identity U X R.LRENLER.Y
2448   955.5173 954.5100 954.5069 3.24 0 24 0.012 +1Score > 17 indicates identity U X R.ATVHCLVR.G
2449 +2 319.1773 954.5101 954.5069 3.29 0 43 0.00015 +1Score > 17 indicates identity U X R.ATVHCLVR.G
2450 +1 478.2626 954.5106 954.5069 3.90 0 51 2.4e-005 +1Score > 17 indicates identity U X R.ATVHCLVR.G
2504 +4 494.7581 987.5016 987.4985 3.15 0 71 3.9e-007 +1Score > 19 indicates identity U X R.VDVISGDQR.N
2505   988.5092 987.5019 987.4985 3.43 0 65 1.4e-006 +1Score > 19 indicates identity U X R.VDVISGDQR.N
2512   992.5448 991.5375 991.5338 3.73 0 50 2.9e-005 +1Score > 17 indicates identity U X R.LPSGYLQSK.W
2513 +4 496.7765 991.5384 991.5338 4.66 0 51 2.4e-005 +1Score > 17 indicates identity U X R.LPSGYLQSK.W
2540   506.7281 1011.4416 1011.4370 4.63 0 19 0.014 +1Score > 13 indicates identity U X R.GEDEAGAHAR.L
2541   338.1547 1011.4423 1011.4370 5.25 0 8 0.16 +1Score > 13 indicates identity U X R.GEDEAGAHAR.L
2589   1042.5192 1041.5119 1041.5091 2.72 0 15 0.058 +1Score > 15 indicates identity U X R.VTDPTGPAER.L
2590 +2 521.7633 1041.5120 1041.5091 2.84 0 55 5.2e-006 +1Score > 15 indicates identity U X R.VTDPTGPAER.L
2648   361.8666 1082.5780 1082.5760 1.80 1 15 0.064 +1Score > 15 indicates identity U X R.ELFEKYVR.F
2719 +2 581.3249 1160.6352 1160.6302 4.35 1 51 2.8e-005 +1Score > 18 indicates identity U X R.DRGLPVSVYR.V
2721 +2 387.8862 1160.6368 1160.6302 5.66 1 35 0.0012 +1Score > 19 indicates identity U X R.DRGLPVSVYR.V
2766   601.8002 1201.5858 1201.5840 1.55 0 70 4.5e-007 +1Score > 19 indicates identity U X R.TVDAVYHNGAR.V
2767   401.5365 1201.5877 1201.5840 3.07 0 55 1.6e-005 +1Score > 19 indicates identity U X R.TVDAVYHNGAR.V
2769 +3 401.8639 1202.5699 1202.5680 1.56 0 68 6.8e-007 +1Score > 19 indicates identity U X R.TVDAVYHNGAR.V + Deamidated (NQ)
2770 +1 602.2933 1202.5720 1202.5680 3.37 0 83 1.9e-008 +1Score > 19 indicates identity U X R.TVDAVYHNGAR.V + Deamidated (NQ)
2785 +5 610.3023 1218.5900 1218.5881 1.62 0 78 6.9e-008 +1Score > 19 indicates identity U X K.TDVPDFAAEVR.L
2848   418.5795 1252.7167 1252.7139 2.18 0 102 8.1e-011 +1Score > 13 indicates identity U X R.LSVVVGDLAQPR.L
2851 +2 627.3671 1252.7196 1252.7139 4.55 0 78 1.8e-008 +1Score > 13 indicates identity U X R.LSVVVGDLAQPR.L
2904 +5 640.3118 1278.6090 1278.6033 4.46 0 29 0.0045 +1Score > 18 indicates identity U X R.FFVETGHFPAAG.-
2927 +3 643.3602 1284.7058 1284.7037 1.64 0 67 8e-007 +1Score > 18 indicates identity U X K.AANVLGTEEILR.L
2928   429.2430 1284.7072 1284.7037 2.68 0 61 2.9e-006 +1Score > 18 indicates identity U X K.AANVLGTEEILR.L
3003 +1 662.7932 1323.5718 1323.5732 -0.98 0 83 8.1e-009 +1Score > 14 indicates identity U X R.YGVWDEVDADR.L
3076 +5 341.9428 1363.7421 1363.7401 1.48 0 19 0.016 +1Score > 14 indicates identity U X R.VHWLHPYATLK.A
3077 +1 682.8786 1363.7426 1363.7401 1.88 0 12 0.098 +1Score > 14 indicates identity U X R.VHWLHPYATLK.A
3079 +6 455.5886 1363.7440 1363.7401 2.85 0 36 0.00038 +1Score > 14 indicates identity U X R.VHWLHPYATLK.A
3095   456.2542 1365.7408 1365.7365 3.14 0 11 0.18 +1Score > 16 indicates identity U X K.GLLQAGGVPADVGGR.F
3098 +5 683.8795 1365.7444 1365.7365 5.83 0 80 1.9e-008 +1Score > 15 indicates identity U X K.GLLQAGGVPADVGGR.F
3216 +16 476.5819 1426.7239 1426.7205 2.39 0 81 3.7e-008 +1Score > 19 indicates identity U X R.LGLAEDAFDHLAR.T
3217 +3 714.3695 1426.7244 1426.7205 2.80 0 98 7.7e-010 +1Score > 19 indicates identity U X R.LGLAEDAFDHLAR.T
3376   522.2884 1563.8434 1563.8369 4.13 1 18 0.048 +1Score > 18 indicates identity U X R.GVPLRVTDPTGPAER.L
3413   545.6299 1633.8679 1633.8464 13.2 1 37 0.0006 +1Score > 17 indicates identity U X R.LPSGYLQSKWVAER.I + Deamidated (NQ)
3490   429.2483 1712.9641 1712.9614 1.59 0 51 1e-005 +1Score > 13 indicates identity U X R.FHLLPVDYVSAAILR.I
3492 +3 857.4901 1712.9656 1712.9614 2.50 0 72 6.9e-008 +1Score > 13 indicates identity U X R.FHLLPVDYVSAAILR.I
3496 +2 571.9983 1712.9731 1712.9614 6.83 0 59 1.4e-006 +1Score > 13 indicates identity U X R.FHLLPVDYVSAAILR.I
3513   863.4189 1724.8232 1724.8192 2.34 0 79 5.1e-008 +1Score > 18 indicates identity U X R.NGACQTSDFVWLSIK.G
3514   575.9492 1724.8258 1724.8192 3.80 0 48 5.4e-005 +1Score > 18 indicates identity U X R.NGACQTSDFVWLSIK.G
3515   576.2780 1725.8122 1725.8032 5.19 0 21 0.021 +1Score > 17 indicates identity U X R.NGACQTSDFVWLSIK.G + Deamidated (NQ)
3516   576.6129 1726.8169 1726.7872 17.2 0 19 0.037 +1Score > 17 indicates identity U X R.NGACQTSDFVWLSIK.G + 2 Deamidated (NQ)
3652 +1 597.3333 1788.9781 1788.9709 4.01 0 76 3.9e-008 +1Score > 15 indicates identity U X R.HVLLTGASGFLGAFLMR.D
3676 +4 602.6664 1804.9774 1804.9658 6.40 0 74 9.2e-008 +1Score > 16 indicates identity U X R.HVLLTGASGFLGAFLMR.D + Oxidation (M)
3780   625.3234 1872.9484 1872.9218 14.2 1 55 1.4e-005 +1Score > 19 indicates identity U X R.TQGPAAKTDVPDFAAEVR.L + Deamidated (NQ)
3783 +1 625.6316 1873.8730 1873.8635 5.05 0 98 5e-010 +1Score > 18 indicates identity U X R.SFGYSLTELDWNTWR.A
3785   938.4441 1874.8736 1874.8475 13.9 0 72 1.9e-007 +1Score > 18 indicates identity U X R.SFGYSLTELDWNTWR.A + Deamidated (NQ)
3875   390.5961 1947.9441 1947.9333 5.54 1 2 3.1 +1Score > 19 indicates identity U X R.ATVHCLVRGEDEAGAHAR.L
3876   487.9934 1947.9445 1947.9333 5.73 1 17 0.098 +1Score > 19 indicates identity U X R.ATVHCLVRGEDEAGAHAR.L
3953 +2 668.0331 2001.0775 2001.0684 4.53 0 67 4.7e-007 +1Score > 17 indicates identity U X R.TVPVHYVLTVGVFDGTAAR.G
3974 +1 670.3474 2008.0204 2008.0225 -1.07 0 42 0.00031 +1Score > 19 indicates identity U X R.LAEDIRPAADVVSVADDPR.H
3975   1005.0197 2008.0248 2008.0225 1.16 0 58 5.8e-006 +1Score > 19 indicates identity U X R.LAEDIRPAADVVSVADDPR.H
3975   1005.0197 2008.0248 2008.0564 -15.7 0 1 3.2 +6Score > 19 indicates identity U X R.GGLIGALPGDGAMAAVFAPAPR.V
3989   673.0214 2016.0424 2016.0164 12.9 1 19 0.051 +1Score > 19 indicates identity U X R.VTDPTGPAERLPSGYLQSK.W + Deamidated (NQ)
4181 +5 597.5734 2386.2645 2386.2393 10.6 0 52 1.9e-005 +1Score > 17 indicates identity U X R.IASRPSAAGGTFHLFNPSSISLR.E + Deamidated (NQ)
4183 +1 796.4304 2386.2694 2386.2393 12.6 0 31 0.0019 +1Score > 17 indicates identity U X R.IASRPSAAGGTFHLFNPSSISLR.E + Deamidated (NQ)
4286   640.5790 2558.2869 2558.2765 4.05 1 33 0.0029 +1Score > 20 indicates identity U X R.YGVWDEVDADRLSVVVGDLAQPR.L
4290 +4 854.1039 2559.2899 2559.2605 11.5 1 32 0.0026 +1Score > 19 indicates identity U X R.YGVWDEVDADRLSVVVGDLAQPR.L + Deamidated (NQ)
4363   899.7768 2696.3086 2696.2752 12.4 1 33 0.002 +1Score > 19 indicates identity U X R.VDVISGDQRNGACQTSDFVWLSIK.G + 2 Deamidated (NQ)
D:\Xcalibur\Data\Jennifer\20250522 PRT1249 Qingyun\PRT1249__2.raw

Score > 20 indicates identity

Score > 15 indicates homology

4422   737.1294 2944.4885 2944.4977 -3.13 1 3 1 -1Score > 20 indicates identity
Score > 15 indicates homology
U X R.IASRPSAAGGTFHLFNPSSISLRECIR.H + Deamidated (NQ)
No other peptide matches in query
4449   766.4361 3061.7153 3061.6713 14.4 1 16 0.026 +1Score > 13 indicates identity U X K.GLLQAGGVPADVGGRFHLLPVDYVSAAILR.I + Deamidated (NQ)
4533   1114.5087 5567.5071 5567.4500 10.3 0 19 0.014 +1Score > 13 indicates identity U X R.VHDDPANAMAPLLHAFEMMTADTDAFYPPMDTTETEAALDGSGIVCPPLTR.E + Deamidated (NQ); 4 Oxidation (M)

4 subsets and intersections (6 subset proteins in total)

Score Mass Subset of
YAHA_ECOLI 67 0 1.1
description
YGGE_ECOLI 56 26619 1.1
Uncharacterized protein YggE OS=Escherichia coli (strain K12) GN=yggE PE=4 SV=1
LYXK_ECOLI 26 55747 1.1
L-xylulose/3-keto-L-gulonate kinase OS=Escherichia coli (strain K12) GN=lyx PE=1 SV=1
2 samesets of LYXK_ECOLI
ODBA_BACSU 26 0
description
M1UA21_BACIU 26 0
description
Q70HZ8_9ACTN 16 0 1.1
description

+2

Accession Score Description
1 YHBW_ECOLI 340 Uncharacterized protein YhbW OS=Escherichia coli (strain K12) GN=yhbW PE=4 SV=1

+3

Accession Score Description
1 CH60_ECOLI 258 60 kDa chaperonin OS=Escherichia coli (strain K12) GN=groL PE=1 SV=2

+4

Accession Score Description
1 TRYP_PIG 176 Trypsin OS=Sus scrofa PE=1 SV=1

+5

Accession Score Description
1 CRP_ECOLI 142 cAMP-activated global transcriptional regulator CRP OS=Escherichia coli (strain K12) GN=crp PE=1 SV=1

+6

Accession Score Description
1 K2C1_HUMAN 119 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6

+7

Accession Score Description
1 EFTU1_ECOLI 103 Elongation factor Tu 1 OS=Escherichia coli (strain K12) GN=tufA PE=1 SV=1

+8

Accession Score Description
1 RL4_ECOLI 74 50S ribosomal protein L4 OS=Escherichia coli (strain K12) GN=rplD PE=1 SV=1

+9

Accession Score Description
1 ATDA_ECOLI 63 Spermidine N(1)-acetyltransferase OS=Escherichia coli (strain K12) GN=speG PE=1 SV=2

+10

Accession Score Description
1 ISPA_ECOLI 61 Farnesyl diphosphate synthase OS=Escherichia coli (strain K12) GN=ispA PE=1 SV=1
Page: 1 2 3 4 Next 

Not what you expected? Try the select summary.