MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1249__1.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:44:49 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,592

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4271)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3925 626.9763 1877.9071 1877.9054 0.89 1 0 4.2 +1Score > 19 indicates identity ARAAGETVMVFPGQGSQR + Deamidated (NQ); Oxidation (M)
2774 457.2020 912.3894 912.3793 11.1 0 0 0.92 +1Score > 13 indicates identity MMTSQQR + 2 Oxidation (M)
2443 562.2599 561.2526 561.2507 3.48 0 0 0.92 +1Score > 13 indicates identity GSQNR + Deamidated (NQ)
3442 460.5623 1378.6651 1378.6841 -13.8 1 0 4.1 +1Score > 19 indicates identity SQFAEAQRLTAR + 2 Deamidated (NQ)
3499 351.9298 1403.6901 1403.6681 15.7 0 0 3.9 +1Score > 19 indicates identity ELAYNAPGNQGLR + 2 Deamidated (NQ)
2951 506.7379 1011.4612 1011.4734 -12.0 1 0 1.6 +1Score > 15 indicates identity DEPGPGRER
4036 659.6854 1976.0344 1976.0327 0.86 1 0 4.2 +1Score > 19 indicates identity IAEDGNPQVLIKNPPSQR + Deamidated (NQ)
3279 431.2284 1290.6634 1290.6853 -17.0 0 0 4.2 +1Score > 19 indicates identity ISTTLLNLMER + Deamidated (NQ)
4384 886.1346 2655.3820 2655.3942 -4.59 1 0 2.6 +1Score > 17 indicates identity IQSGELSAIPHQLIMDKIYDVLR + Deamidated (NQ); Oxidation (M)
3796 888.4624 1774.9102 1774.8751 19.8 1 0 3.9 +1Score > 19 indicates identity RQLPWTNAFADAQTR + Deamidated (NQ)
4426 979.4970 2935.4692 2935.4776 -2.87 0 0 4 +1Score > 19 indicates identity YSNLILNLFSLMVDANIPDIALEPDK + 2 Deamidated (NQ); Oxidation (M)
3725 435.2402 1736.9317 1736.9420 -5.96 1 0 2.4 +1Score > 17 indicates identity VNQPQDLGIALARAIR + 3 Deamidated (NQ)
4013 492.9839 1967.9065 1967.8901 8.31 0 0 3.1 +1Score > 18 indicates identity FSPFTAGNVVNHGFETDK + 2 Deamidated (NQ)
4362 654.5709 2614.2545 2614.2804 -9.92 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 LPQTQARNMLIEAGGIMMPGNPIK + 3 Deamidated (NQ); 2 Oxidation (M)
3859 914.9844 1827.9542 1827.9699 -8.56 1 0 3.5 +1Score > 18 indicates identity ILPPAIVNEMVMTGRR + 2 Oxidation (M)
4272 832.0825 2493.2257 2493.2203 2.17 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 MSEALLNAGRQTLMLELQEASR + Deamidated (NQ); 2 Oxidation (M)
3669 547.3051 1638.8935 1638.8651 17.3 1 0 1.8 +1Score > 15 indicates identity YGCLETVASLSALKK
3845 607.9971 1820.9695 1821.0004 -17.0 1 0 2.9 +1Score > 17 indicates identity HMELLAHSILKLICK + Oxidation (M)
4012 491.9746 1963.8693 1963.9019 -16.6 0 0 2.1 +1Score > 16 indicates identity VALQGNMDPSMLYAPPAR + 2 Deamidated (NQ); 2 Oxidation (M)
4454 796.4006 3181.5733 3181.5536 6.19 1 0 3.7 +1Score > 18 indicates identity MSVSDAEPVMLEQISRISQQIGYYLHR + 2 Oxidation (M)
4189 1137.1113 2272.2080 2272.1984 4.24 1 0 2.3 +1Score > 16 indicates identity MSTQEATLQQPLLQAIDLKK + Deamidated (NQ); Oxidation (M)
4225 805.7641 2414.2705 2414.2378 13.5 1 0 3.6 +1Score > 18 indicates identity FVEGKPLMLEDSYMPVKLFR + Oxidation (M)
3982 485.9836 1939.9053 1939.9019 1.74 1 0 2.9 +1Score > 17 indicates identity LNDEIVMTPEMNFSKR + Deamidated (NQ); Oxidation (M)
4004 653.6812 1958.0218 1958.0255 -1.90 0 0 3.9 +1Score > 19 indicates identity LDRPTSGVLLMGLSSEAGR
3228 423.2117 1266.6133 1266.5914 17.2 0 0 3.4 +1Score > 18 indicates identity FVDMVDLANAR + Deamidated (NQ); Oxidation (M)
3010 350.1464 1047.4174 1047.4001 16.5 0 0 0.97 +1Score > 13 indicates identity MTMNSFER + Deamidated (NQ); 2 Oxidation (M)
3743 581.6664 1741.9774 1741.9661 6.45 1 0 1.5 +1Score > 14 indicates identity MIAHLQKLSFGQVVR + Oxidation (M)
2708 415.2207 828.4268 828.4395 -15.3 0 0 1.6 +1Score > 15 indicates identity AFIHWR
3307 655.8685 1309.7224 1309.6998 17.3 1 0 1.5 +1Score > 14 indicates identity MMLARHALALPA + Oxidation (M)
2926 332.4921 994.4545 994.4607 -6.30 0 0 2.7 +1Score > 17 indicates identity FEGTGVEEK
3959 640.9744 1919.9014 1919.9267 -13.2 0 0 4.1 +1Score > 19 indicates identity MISPQSIAVACAATGMVGR + Deamidated (NQ)
3973 968.9348 1935.8550 1935.8785 -12.1 0 0 2 +1Score > 16 indicates identity DEAHNVMSNLYYPEVR
4429 734.8810 2935.4949 2935.4895 1.83 0 0 3.7 +1Score > 18 indicates identity AVSGLNILTLMNNDMALIQLHHISQR + 2 Deamidated (NQ); 2 Oxidation (M)
3474 349.1996 1392.7693 1392.7653 2.90 1 0 1.6 +1Score > 15 indicates identity YFPNQKLVAALK + 2 Deamidated (NQ)
3224 630.3146 1258.6146 1258.6153 -0.51 1 0 3.7 +1Score > 18 indicates identity GDRANAVANLEK + 2 Deamidated (NQ)
4149 516.4938 2061.9461 2061.9347 5.54 1 0 4.1 +1Score > 19 indicates identity MSSMTTTDNKAFLNELAR + Deamidated (NQ); 2 Oxidation (M)
4266 619.5906 2474.3333 2474.3070 10.6 1 0 2.4 +1Score > 16 indicates identity FFPAEANGGVKALQAIAGPFSQVR
4135 512.7521 2046.9793 2046.9694 4.85 1 0 4.2 +1Score > 19 indicates identity RCYEGVHALLDNGYQPR
4234 607.0628 2424.2221 2424.1858 15.0 0 0 4.3 +1Score > 19 indicates identity CLTAPGENALWFMYEPVLVSK
3326 441.8650 1322.5732 1322.5674 4.39 0 0 1.7 +1Score > 15 indicates identity NSSGGPSMGGPGFR + Oxidation (M)
4118 510.2425 2036.9409 2036.9619 -10.3 1 0 3.5 +1Score > 18 indicates identity IQRAGTMSGGEQQMLAIGR + 2 Deamidated (NQ); 2 Oxidation (M)
3660 534.9389 1601.7949 1601.7798 9.43 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 GIQDGDTVRLWNAR + 2 Deamidated (NQ)
4130 512.5012 2045.9757 2045.9389 18.0 0 0 4 +1Score > 19 indicates identity LEAAVAQSEQQGEAALSDAR + 3 Deamidated (NQ)
3987 487.7430 1946.9429 1946.9084 17.7 0 0 4.2 +1Score > 19 indicates identity LPNNSSPFYSTMGFLVR + 2 Deamidated (NQ); Oxidation (M)
4470 934.9506 3735.7733 3735.7780 -1.26 0 0 2.9 +1Score > 17 indicates identity QQLGLDQPLYHQFWHYISNAVQGDFGLSMVSR + 2 Deamidated (NQ)
1 300.1509 299.1436
2 300.1822 299.1749
3 300.1822 299.1749
4 301.0244 300.0171
5 301.0601 300.0528
6 301.0603 300.0530
7 301.0603 300.0530
8 301.0880 300.0807
9 301.1048 300.0975
10 301.1049 300.0976
11 301.1053 300.0980
12 301.1060 300.0987
13 301.1063 300.0990
14 301.1248 300.1175
15 301.1287 300.1214
16 301.1416 300.1343
17 301.1419 300.1346
18 301.1419 300.1346
19 301.1420 300.1347
20 301.1421 300.1348
21 301.1421 300.1348
22 301.1422 300.1349
23 301.1424 300.1351
24 301.1424 300.1351
25 301.1425 300.1352
26 301.1426 300.1353
27 301.1426 300.1353
28 301.1426 300.1353
29 301.1427 300.1354
30 301.1428 300.1355
31 301.1428 300.1355
32 301.1429 300.1356
33 301.1429 300.1356
34 301.1429 300.1356
35 301.1430 300.1357
36 301.1431 300.1358
37 301.1431 300.1358
38 301.1435 300.1362
39 301.1638 300.1565
40 302.1035 301.0962
41 302.1602 301.1529
42 302.1975 301.1902
43 302.1978 301.1905
44 302.1979 301.1906
45 303.0396 302.0323
46 303.0762 302.0689
47 303.0765 302.0692
48 303.0841 302.0768
49 303.0843 302.0770
50 303.0843 302.0770
51 303.0849 302.0776
52 303.0854 302.0781
53 303.0855 302.0782
54 303.1211 302.1138
55 303.1211 302.1138
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/