MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1249__1.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:44:49 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,592

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 4271)

Page: Previous 1 2 3 4 5 6 7 8 9 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2876 486.8046 971.5946 971.6127 -18.6 1 2 0.68 +1Score > 13 indicates identity TSIARLLAK
2707 414.2061 826.3976 826.4086 -13.2 1 2 1.6 +1Score > 16 indicates identity REFYGR
3679 559.6218 1675.8436 1675.8716 -16.7 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GFPGVLAAADAMVKTGR + Oxidation (M)
3524 475.5824 1423.7254 1423.7235 1.32 0 2 2.6 +1Score > 18 indicates identity VFVEVFDEEALK
3348 669.8168 1337.6190 1337.6260 -5.23 0 2 2.1 +1Score > 17 indicates identity WCAFLLQMPR + Deamidated (NQ); Oxidation (M)
4412 924.1354 2769.3844 2769.3358 17.6 1 2 3.2 +1Score > 19 indicates identity NVVVLAGNHEINFNGNYTARLANHK + 5 Deamidated (NQ)
3042 537.2560 1072.4974 1072.4938 3.44 1 2 1.1 +1Score > 14 indicates identity KDFNSYGSR
2731 435.7583 869.5020 869.5083 -7.16 1 2 1 +1Score > 14 indicates identity ERLLSPR
3086 370.1584 1107.4534 1107.4655 -11.0 0 2 0.73 +1Score > 13 indicates identity AMLDGQDWR + Deamidated (NQ); Oxidation (M)
3363 337.4405 1345.7329 1345.7136 14.3 1 2 1.9 +1Score > 17 indicates identity MSELIVSRQQR
3947 956.4371 1910.8596 1910.8792 -10.2 0 2 2.7 +1Score > 18 indicates identity ALNSVEASQPHQDQMEK
4093 672.6927 2015.0563 2015.0397 8.21 1 2 2.7 +1Score > 18 indicates identity NTLWNQIKANMLDIPVK + 2 Deamidated (NQ); Oxidation (M)
2585 688.3452 687.3379 687.3300 11.5 0 2 1 +1Score > 14 indicates identity QSGPGSR
3762 438.9881 1751.9233 1751.9431 -11.3 1 2 2.3 +1Score > 18 indicates identity GFHVERDQVGNILIR
4292 844.7336 2531.1790 2531.2292 -19.9 1 2 2.7 +1Score > 18 indicates identity QYGDFENGIPVHDTIARVVSQGK + 2 Deamidated (NQ)
4035 659.6852 1976.0338 1976.0075 13.3 1 1 3.2 +1Score > 19 indicates identity EPRANTQAAEHILQEIR + Deamidated (NQ)
2800 929.5177 928.5104 928.5090 1.53 1 1 2.7 +1Score > 18 indicates identity RLEQIDR
3742 581.6658 1741.9756 1741.9661 5.41 1 1 1.1 +1Score > 14 indicates identity MIAHLQKLSFGQVVR + Oxidation (M)
4410 921.4666 2761.3780 2761.4147 -13.3 1 1 3 +1Score > 19 indicates identity DPLHQFASQQTPEAQLQALQDKIR
2735 437.2448 872.4750 872.4603 16.9 0 1 3.6 +1Score > 19 indicates identity INAAQDLK + Deamidated (NQ)
2847 318.5056 952.4950 952.4800 15.7 1 1 2.6 +1Score > 18 indicates identity FGGMKIER + Oxidation (M)
3158 406.8932 1217.6578 1217.6438 11.5 0 1 2.3 +1Score > 18 indicates identity MVVGEGLLSAAR + Oxidation (M)
3618 744.3301 1486.6456 1486.6697 -16.2 1 1 1.4 +1Score > 15 indicates identity MDSFRDVWMLR + 2 Oxidation (M)
4050 995.0073 1988.0000 1988.0135 -6.79 0 1 3.5 +1Score > 19 indicates identity TLTIAAPGAASMQLAENALK + 2 Deamidated (NQ); Oxidation (M)
3795 592.6426 1774.9060 1774.8751 17.4 1 1 3.2 +1Score > 19 indicates identity RQLPWTNAFADAQTR + Deamidated (NQ)
2543 332.7039 663.3932 663.3955 -3.45 0 1 0.97 +1Score > 14 indicates identity GLAYIK
3382 340.9359 1359.7145 1359.6929 15.9 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 AMTPVRALSGGER + Oxidation (M)
3065 363.4875 1087.4407 1087.4352 4.99 0 1 0.76 +1Score > 13 indicates identity CHQNATAER + 2 Deamidated (NQ)
3236 423.5234 1267.5484 1267.5689 -16.2 0 1 1.5 +1Score > 15 indicates identity NVMDMFIDGAR
4122 680.0188 2037.0346 2037.0643 -14.6 1 1 3.3 +1Score > 19 indicates identity LTPEQWAQAGRLIAAGTPR + 2 Deamidated (NQ)
4277 837.0870 2508.2392 2508.2240 6.06 1 1 0.84 +1Score > 20 indicates identity
Score > 13 indicates homology		 MDKIFVDEAVNELQTIQDMLR + Deamidated (NQ)
4226 604.5762 2414.2757 2414.2378 15.7 1 1 2.4 +1Score > 18 indicates identity FVEGKPLMLEDSYMPVKLFR + Oxidation (M)
3703 572.3332 1713.9778 1713.9600 10.4 1 1 0.88 +1Score > 13 indicates identity ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M)
4205 593.0727 2368.2617 2368.2386 9.75 1 1 2.2 +1Score > 17 indicates identity GNAAELFSGIRHIAINILTNDK + 2 Deamidated (NQ)
3752 584.6448 1750.9126 1750.9002 7.04 0 1 2.6 +1Score > 18 indicates identity VNNFQVSAASTPFLTR
3178 310.6449 1238.5505 1238.5278 18.4 0 1 1.7 +1Score > 16 indicates identity SYMYDFIQR + Deamidated (NQ); Oxidation (M)
3381 340.9357 1359.7137 1359.6929 15.3 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 AMTPVRALSGGER + Oxidation (M)
3645 768.9084 1535.8022 1535.7952 4.58 1 1 2.4 +1Score > 17 indicates identity LIMGFAPAMLERR + 2 Oxidation (M)
2997 520.7262 1039.4378 1039.4427 -4.63 1 1 0.78 +1Score > 13 indicates identity VNDTMCKR + Deamidated (NQ); Oxidation (M)
3445 345.9319 1379.6985 1379.6721 19.1 0 1 2.4 +1Score > 17 indicates identity FPYVNANVIDAR + 2 Deamidated (NQ)
3505 470.2529 1407.7369 1407.7510 -10.1 0 1 2.4 +1Score > 17 indicates identity HAAQGIIDWLGVK + Deamidated (NQ)
4163 522.2385 2084.9249 2084.9592 -16.5 0 1 2 +1Score > 16 indicates identity DGFLQPSIQAFNQYWDR + Deamidated (NQ)
4392 896.7653 2687.2741 2687.2717 0.90 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 RLMTEQHQGLGAAIISNMEQVCAK + 3 Deamidated (NQ)
4453 1061.5312 3181.5718 3181.5472 7.72 1 1 3.1 +1Score > 18 indicates identity RAVFLGMLLQAMQQFTGMNIIMYYAPR + 3 Deamidated (NQ); Oxidation (M)
2969 510.7743 1019.5340 1019.5321 1.89 0 1 3.2 +1Score > 19 indicates identity DMVLATLNK + Oxidation (M)
3760 438.9878 1751.9221 1751.8941 16.0 0 1 2.7 +1Score > 18 indicates identity LAEPAPTGEQLQNILR + 3 Deamidated (NQ)
3673 831.4332 1660.8518 1660.8283 14.2 1 1 3.9 +1Score > 19 indicates identity AMWPSTAKWLNDLK + Deamidated (NQ)
3309 656.3325 1310.6504 1310.6506 -0.14 0 1 3 +1Score > 18 indicates identity QDVYYLEKPR + Deamidated (NQ)
4195 767.7291 2300.1655 2300.1648 0.31 1 1 3.4 +1Score > 19 indicates identity EALRGHAAQLSQYNQVLASLK + 4 Deamidated (NQ)
4239 812.7917 2435.3533 2435.3094 18.0 1 1 0.96 +1Score > 13 indicates identity SLGVGFATRQVASMTKPTTIIEK + Deamidated (NQ)
4391 895.4613 2683.3621 2683.3470 5.61 0 1 3.2 +1Score > 19 indicates identity ALAQAMHQAGKPLGFMCIAPAMLPK + 2 Oxidation (M)
4415 931.4655 2791.3747 2791.4037 -10.4 1 1 3.5 +1Score > 19 indicates identity AAETLVQQGFVVLPYCGADPVLCKR + Deamidated (NQ)
3147 401.5361 1201.5865 1201.5938 -6.12 1 1 3.9 +1Score > 19 indicates identity AEQAALQADKR + 2 Deamidated (NQ)
4359 654.3189 2613.2465 2613.2964 -19.1 1 1 4.1 +1Score > 20 indicates identity LPQTQARNMLIEAGGIMMPGNPIK + 2 Deamidated (NQ); 2 Oxidation (M)
4478 1040.5190 4158.0469 4158.0790 -7.72 1 1 2.3 +1Score > 17 indicates identity MNTSHVRVVTHMCGFLVWLYSLSMLPPMVVALFYK + 2 Oxidation (M)
2872 485.7548 969.4950 969.4880 7.31 1 1 2.1 +1Score > 17 indicates identity VDDTGKAHK
4121 1019.5228 2037.0310 2037.0643 -16.3 1 1 3.6 +1Score > 19 indicates identity LTPEQWAQAGRLIAAGTPR + 2 Deamidated (NQ)
2606 352.1541 702.2936 702.3047 -15.7 0 1 0.83 +1Score > 13 indicates identity YDFMK
2960 508.7563 1015.4980 1015.5046 -6.46 1 1 2.6 +1Score > 17 indicates identity RANAQAAANK + 2 Deamidated (NQ)
3701 572.3328 1713.9766 1713.9600 9.69 1 1 0.95 +1Score > 13 indicates identity ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M)
4190 758.7366 2273.1880 2273.1573 13.5 1 1 2.1 +1Score > 17 indicates identity INKDDIVINDIAVSLSNICR + 2 Deamidated (NQ)
3180 310.8892 1239.5277 1239.5037 19.3 0 1 0.83 +1Score > 13 indicates identity DSMGQSLSGGER + Deamidated (NQ); Oxidation (M)
3211 628.3638 1254.7130 1254.7044 6.90 1 1 1.5 +1Score > 15 indicates identity ERQAIEQLIR
4325 859.7720 2576.2942 2576.3082 -5.43 1 1 3.7 +1Score > 19 indicates identity QGQQSAELRLHPQDLGEVQISLK + 3 Deamidated (NQ)
4371 656.3083 2621.2041 2621.2400 -13.7 1 1 2.9 +1Score > 18 indicates identity CPNGLPGVENRMQLLFSSGVMTGR + 2 Deamidated (NQ)
3750 583.9365 1748.7877 1748.8217 -19.5 1 1 2.3 +1Score > 17 indicates identity RNDDNTWTVTVADLK + 2 Deamidated (NQ)
4146 687.3499 2059.0279 2059.0156 5.94 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 WGIVNRVVSQAELMDNAR + 2 Deamidated (NQ)
2843 476.2513 950.4880 950.4756 13.1 1 1 2.8 +1Score > 18 indicates identity KMDAHPPR
3647 515.6066 1543.7980 1543.7995 -0.96 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 DDKTLSTNPLVWR
3980 647.6115 1939.8127 1939.8170 -2.23 0 1 0.84 +1Score > 13 indicates identity GISEQELNEYQQNVQR + 6 Deamidated (NQ)
3186 311.1481 1240.5633 1240.5684 -4.09 0 1 2.3 +1Score > 17 indicates identity EQASGAYSVSSR
4148 687.6950 2060.0632 2060.0386 11.9 1 1 3.4 +1Score > 19 indicates identity SQLQGLEKTDSGIQATLDR + Deamidated (NQ)
3194 415.1916 1242.5530 1242.5663 -10.7 0 1 1.2 +1Score > 14 indicates identity CTEEHQAIVR + Deamidated (NQ)
2832 473.2422 944.4698 944.4749 -5.40 0 1 3.2 +1Score > 18 indicates identity IPQQGMVR + Deamidated (NQ); Oxidation (M)
3663 817.9171 1633.8196 1633.8100 5.91 0 1 4 +1Score > 19 indicates identity QLIEAGFETGHAYAK
3811 597.6699 1789.9879 1790.0050 -9.58 1 1 0.98 +1Score > 13 indicates identity LTPLGRQLSQLPVDPR + Deamidated (NQ)
4051 664.3475 1990.0207 1990.0306 -4.97 1 1 3.5 +1Score > 19 indicates identity IASAIGRADGNPMYVISQK
4329 861.7630 2582.2672 2582.2976 -11.8 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 KALQLIPEGATGPGNSANWQGLGSSK + 2 Deamidated (NQ)
4136 513.7362 2050.9157 2050.9167 -0.48 1 1 2.1 +1Score > 16 indicates identity GDDIHWSMTGDNQKLYR + Oxidation (M)
4223 604.5744 2414.2685 2414.2378 12.7 1 1 3.2 +1Score > 18 indicates identity FVEGKPLMLEDSYMPVKLFR + Oxidation (M)
4217 803.7571 2408.2495 2408.2369 5.23 1 1 3.5 +1Score > 19 indicates identity LKANLINHNLTQEQVMEAALR + 3 Deamidated (NQ)
3458 347.9356 1387.7133 1387.7030 7.40 1 1 4 +1Score > 19 indicates identity MKALHFGAGNIGR + Deamidated (NQ); Oxidation (M)
4116 679.0212 2034.0418 2034.0792 -18.4 1 1 3.1 +1Score > 18 indicates identity RNQTLLTLHSLNMLHSR + Deamidated (NQ)
3188 311.1491 1240.5673 1240.5724 -4.13 0 1 2.1 +1Score > 16 indicates identity AEVYGPFSDTR
3173 615.8093 1229.6040 1229.6152 -9.10 1 1 2.6 +1Score > 17 indicates identity AELAEREWAR
3700 572.3326 1713.9760 1713.9600 9.34 1 1 1 +1Score > 13 indicates identity ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M)
4129 682.9991 2045.9755 2045.9946 -9.33 0 1 3.5 +1Score > 19 indicates identity FFNEAQELLASFNLSTSK + Deamidated (NQ)
2553 670.4272 669.4199 669.4173 3.86 0 0 0.89 +1Score > 13 indicates identity ATPLIR
4473 984.2628 3933.0221 3933.0242 -0.53 1 0 1.7 +1Score > 15 indicates identity MRFNPNLDPAWFGGVMAIINNITMLAIVLTGSALIR + 4 Deamidated (NQ)
4120 1019.5206 2037.0266 2037.0418 -7.45 1 0 4 +1Score > 19 indicates identity WVKQISEELHLDEILNA + Deamidated (NQ)
3751 583.9402 1748.7988 1748.8217 -13.1 1 0 2.8 +1Score > 17 indicates identity RNDDNTWTVTVADLK + 2 Deamidated (NQ)
2823 471.7758 941.5370 941.5447 -8.12 0 0 1.8 +1Score > 16 indicates identity HLITFGVR
2981 515.7509 1029.4872 1029.4702 16.6 0 0 1.4 +1Score > 14 indicates identity QMPGHFGQK + Deamidated (NQ)
4029 659.6844 1976.0314 1976.0327 -0.66 1 0 4.1 +1Score > 19 indicates identity IAEDGNPQVLIKNPPSQR + Deamidated (NQ)
2797 310.1584 927.4534 927.4450 9.00 0 0 1.6 +1Score > 15 indicates identity SGYFVAQR + Deamidated (NQ)
3612 742.8820 1483.7494 1483.7783 -19.5 0 0 3.3 +1Score > 18 indicates identity AVGGQITLHAFDAGK
3704 572.3339 1713.9799 1713.9600 11.6 1 0 0.91 +1Score > 13 indicates identity ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M)
3632 378.1653 1508.6321 1508.6354 -2.19 0 0 0.91 +1Score > 13 indicates identity SNFDAMSGQYYAR
3232 634.3646 1266.7146 1266.6932 16.9 0 0 1.1 +1Score > 13 indicates identity TPVALLDAPASGR
3370 451.2200 1350.6382 1350.6602 -16.3 0 0 2.7 +1Score > 17 indicates identity NNVLSGLFCGLR + 2 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/