MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1249__1.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:44:49 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,592

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 4271)

Page: Previous 1 2 3 4 5 6 7 8 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3843 607.0009 1817.9809 1817.9781 1.50 1 4 1.1 +1Score > 17 indicates identity VLNLNQRTVSSIMTSR
3222 420.5425 1258.6057 1258.6014 3.39 1 4 1.5 +1Score > 18 indicates identity GDASGDALNRQR
3260 640.8044 1279.5942 1279.6045 -7.98 0 4 1.5 +1Score > 18 indicates identity ADEGYDVVGTVR
3210 419.2445 1254.7117 1254.7118 -0.096 1 4 0.82 +1Score > 15 indicates identity AGLAELGPMKIR
3367 337.4416 1345.7373 1345.7136 17.6 1 4 1.1 +1Score > 17 indicates identity MSELIVSRQQR
4002 653.6786 1958.0140 1958.0255 -5.89 0 4 1.8 +1Score > 19 indicates identity LDRPTSGVLLMGLSSEAGR
3945 954.4387 1906.8628 1906.8771 -7.48 0 4 1.5 +1Score > 18 indicates identity IAFLFTGQGSQYVNMGR + 3 Deamidated (NQ); Oxidation (M)
4204 786.4075 2356.2007 2356.1621 16.4 0 4 2.1 +1Score > 19 indicates identity GMPQIEVTFDIDADGILHVSAK + Deamidated (NQ)
4486 1160.0754 4636.2725 4636.2386 7.30 1 4 1.4 +1Score > 17 indicates identity QTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQR + 5 Deamidated (NQ); 3 Oxidation (M)
2844 477.2413 952.4680 952.4515 17.4 0 3 1.2 +1Score > 17 indicates identity TGWAPEHR
3585 728.3683 1454.7220 1454.7405 -12.7 0 3 1.7 +1Score > 18 indicates identity SFEPLENALAHVK + Deamidated (NQ)
4154 690.9860 2069.9362 2069.9694 -16.1 1 3 1.4 +1Score > 17 indicates identity LEFSIYRYNPDVDDAPR + Deamidated (NQ)
3280 431.2284 1290.6634 1290.6642 -0.64 0 3 2.1 +1Score > 19 indicates identity LLAMFDEVTPR
3716 864.4861 1726.9576 1726.9577 -0.041 1 3 1.1 +1Score > 16 indicates identity LNALEGKLQTGEISVR
4145 687.3444 2059.0114 2058.9900 10.4 1 3 0.68 +1Score > 20 indicates identity
Score > 14 indicates homology		 MIKENQLMMLAHGVASPR + 2 Deamidated (NQ); 2 Oxidation (M)
2520 322.1654 642.3162 642.3085 12.0 0 3 0.47 +1Score > 13 indicates identity HTTER
4106 508.5065 2029.9969 2030.0028 -2.93 1 3 0.58 +1Score > 20 indicates identity
Score > 13 indicates homology		 AEPTSGGGQLSTAQKQNISR + Deamidated (NQ)
3118 585.7507 1169.4868 1169.4998 -11.1 0 3 0.79 +1Score > 15 indicates identity VMFGWMPDR + 2 Oxidation (M)
4128 682.3548 2044.0426 2044.0299 6.20 1 3 2.3 +1Score > 19 indicates identity IEFRVTTNPGQPMQPIAK + 2 Deamidated (NQ); Oxidation (M)
4461 856.4357 3421.7137 3421.6937 5.83 1 3 1.9 +1Score > 18 indicates identity MSQILLQPANAMITLENVNKWYGQFHVLK + 4 Deamidated (NQ); 2 Oxidation (M)
2768 454.2392 906.4638 906.4480 17.4 1 3 2.2 +1Score > 19 indicates identity EVQKEMK + Oxidation (M)
4158 519.7515 2074.9769 2075.0106 -16.2 1 3 1.9 +1Score > 18 indicates identity RVGETAWAQDTIADCLLR + Deamidated (NQ)
4109 678.0076 2031.0010 2030.9942 3.31 0 3 2.3 +1Score > 19 indicates identity LILGEAAETTLCGLDDNAR
2792 309.4755 925.4047 925.3964 8.98 0 3 0.71 +1Score > 14 indicates identity VGMNDFAR + Deamidated (NQ); Oxidation (M)
3724 868.9831 1735.9516 1735.9468 2.77 1 3 1 +1Score > 16 indicates identity IVTEEVVVKNHNAVGK + Deamidated (NQ)
3963 962.4359 1922.8572 1922.8462 5.76 1 3 1.1 +1Score > 16 indicates identity EQGMEGARDLALEMANR + Deamidated (NQ); 2 Oxidation (M)
4242 488.4532 2437.2296 2437.2570 -11.2 1 3 1.9 +1Score > 18 indicates identity SNIGHPQGAAGVAGVIKMVMALQR + Deamidated (NQ); 2 Oxidation (M)
4179 735.0566 2202.1480 2202.1579 -4.51 1 3 2.2 +1Score > 19 indicates identity LEPVPNADAPLGPGQVRVAMR + Oxidation (M)
3723 868.9823 1735.9500 1735.9468 1.85 1 3 1.1 +1Score > 16 indicates identity IVTEEVVVKNHNAVGK + Deamidated (NQ)
3237 636.3625 1270.7104 1270.6881 17.6 1 3 1.6 +1Score > 18 indicates identity DGKINLLDLNR + Deamidated (NQ)
3532 713.8943 1425.7740 1425.7616 8.73 0 3 1.3 +1Score > 17 indicates identity ALQEQIPDFIPR
4147 687.6724 2059.9954 2060.0109 -7.53 1 3 2.5 +1Score > 19 indicates identity SNIINLEWQQIDMQRR + Deamidated (NQ); Oxidation (M)
3187 621.2908 1240.5670 1240.5605 5.25 0 3 1.2 +1Score > 16 indicates identity ISDNTVMTTSR + Deamidated (NQ); Oxidation (M)
3478 697.8734 1393.7322 1393.7565 -17.4 1 3 1.5 +1Score > 17 indicates identity GAVPDAVADPNLKK
2709 415.2318 828.4490 828.4527 -4.44 0 3 1.5 +1Score > 17 indicates identity LALMPQR + Deamidated (NQ)
3192 622.2811 1242.5476 1242.5663 -15.0 0 3 0.63 +1Score > 13 indicates identity CTEEHQAIVR + Deamidated (NQ)
4077 670.6843 2009.0311 2008.9966 17.1 1 3 2.3 +1Score > 19 indicates identity HRIQVVFQDPNSSLNPR + 3 Deamidated (NQ)
4469 926.2099 3700.8105 3700.7641 12.5 0 3 2 +1Score > 18 indicates identity IVIEEFLDGEEASFIVMVDGEHVLPMATSQDHK + Oxidation (M)
3485 349.9409 1395.7345 1395.7146 14.2 1 3 1.5 +1Score > 17 indicates identity RYYSLTTHNLK + Deamidated (NQ)
3030 532.7549 1063.4952 1063.5047 -8.84 0 3 1.6 +1Score > 17 indicates identity GQGAQLNGYR + Deamidated (NQ)
3444 345.9317 1379.6977 1379.6721 18.5 0 3 1.6 +1Score > 17 indicates identity FPYVNANVIDAR + 2 Deamidated (NQ)
4060 500.7539 1998.9865 1999.0011 -7.28 1 3 2.6 +1Score > 19 indicates identity TAKTPQWASQITGIPEDR + Deamidated (NQ)
2710 415.2331 828.4516 828.4453 7.61 0 3 1.3 +1Score > 16 indicates identity AGIGINAGR + Deamidated (NQ)
2456 573.2647 572.2574 572.2554 3.51 0 3 0.54 +1Score > 13 indicates identity ADPNR + Deamidated (NQ)
4376 526.8545 2629.2361 2629.2368 -0.26 1 3 2.3 +1Score > 19 indicates identity TTEQSWQQQTRTSQAAPVQAQPR + 3 Deamidated (NQ)
4157 692.6642 2074.9708 2074.9861 -7.37 1 3 2 +1Score > 18 indicates identity NPTSPYSFVNYLHKHDR + Deamidated (NQ)
3281 323.6735 1290.6649 1290.6788 -10.8 0 3 2.5 +1Score > 19 indicates identity TGLMMLVGSINR
3884 616.3342 1845.9808 1845.9737 3.83 1 3 2.4 +1Score > 19 indicates identity ALGWKPQETFESGIRK
4282 839.4453 2515.3141 2515.3138 0.097 1 3 1.9 +1Score > 18 indicates identity RMISGEMDVVLVPQGTLIEQIR + 2 Oxidation (M)
4298 638.8202 2551.2517 2551.2377 5.50 1 3 2.2 +1Score > 19 indicates identity MHEKLSTDTQPLNYFNALSAVR + Deamidated (NQ); Oxidation (M)
3964 962.4365 1922.8584 1922.8462 6.38 1 3 1.3 +1Score > 16 indicates identity EQGMEGARDLALEMANR + Deamidated (NQ); 2 Oxidation (M)
3726 435.2403 1736.9321 1736.8992 19.0 1 3 1.4 +1Score > 17 indicates identity MVALNLRQHISDPAR + Deamidated (NQ); Oxidation (M)
3951 638.2956 1911.8650 1911.8850 -10.5 1 3 2.1 +1Score > 18 indicates identity SKDNNLEAFYLATPDGR + 2 Deamidated (NQ)
3510 353.1926 1408.7413 1408.7133 19.9 1 3 1.7 +1Score > 17 indicates identity QTRYGMDGKPIK + Oxidation (M)
4173 708.6932 2123.0578 2123.0681 -4.84 0 3 2.4 +1Score > 19 indicates identity IGEHTPSALAIMENANVLAR + Deamidated (NQ); Oxidation (M)
4016 659.3505 1975.0297 1975.0208 4.49 1 2 2.2 +1Score > 18 indicates identity RGGGNERPQNNRPAAKPR + Deamidated (NQ)
4152 518.2451 2068.9513 2068.9854 -16.5 1 2 2 +1Score > 18 indicates identity LEFSIYRYNPDVDDAPR
3938 634.9634 1901.8684 1901.8867 -9.65 1 2 2.3 +1Score > 19 indicates identity NRYLLHLNQEASDGDR + 2 Deamidated (NQ)
2927 332.5131 994.5175 994.5270 -9.54 1 2 1.6 +1Score > 17 indicates identity RFTMELAK
3329 331.6708 1322.6541 1322.6401 10.6 1 2 2.2 +1Score > 18 indicates identity SFTMSNPNRIR + Deamidated (NQ)
4108 407.2065 2030.9961 2030.9909 2.57 1 2 2.8 +1Score > 19 indicates identity AVTDSDEPPVVRYDVQNK
4058 1000.0103 1998.0060 1997.9707 17.7 0 2 2.7 +1Score > 19 indicates identity GQNNLWNNGGIQYAPPVR + Deamidated (NQ)
3364 337.4406 1345.7333 1345.7282 3.81 0 2 1.6 +1Score > 17 indicates identity GEYLPIVELWK
4080 670.6863 2009.0371 2009.0542 -8.51 0 2 2.4 +1Score > 19 indicates identity LNGGQVSLPGTLDATSINPR
4119 680.0159 2037.0259 2037.0275 -0.78 0 2 2.6 +1Score > 19 indicates identity MQTVMQTLLPYLNQALR + 2 Deamidated (NQ); Oxidation (M)
2903 493.7738 985.5330 985.5192 14.0 0 2 1.7 +1Score > 17 indicates identity VAVGLEQNR + Deamidated (NQ)
3586 728.3693 1454.7240 1454.7405 -11.3 0 2 2.4 +1Score > 19 indicates identity SFEPLENALAHVK + Deamidated (NQ)
3481 349.4426 1393.7413 1393.7202 15.2 0 2 1.5 +1Score > 17 indicates identity IDVPQQTHDTLK
2519 322.1652 642.3158 642.3085 11.4 0 2 0.59 +1Score > 13 indicates identity HTTER
4452 1047.8401 3140.4985 3140.4617 11.7 1 2 2.8 +1Score > 19 indicates identity VTSNSVMNSFFIPRLGSQIYAMAGMQTR + 3 Deamidated (NQ); 2 Oxidation (M)
2727 432.7039 863.3932 863.4025 -10.7 0 2 1.2 +1Score > 16 indicates identity VDYPGGEK
3124 592.3156 1182.6166 1182.6033 11.3 0 2 1.6 +1Score > 17 indicates identity GITSGFAFLDR
3784 442.7285 1766.8849 1766.8621 12.9 1 2 0.96 +1Score > 20 indicates identity
Score > 15 indicates homology		 VFIGSCTNSRIEDLR + Deamidated (NQ)
3331 331.6710 1322.6549 1322.6401 11.2 1 2 2.4 +1Score > 18 indicates identity SFTMSNPNRIR + Deamidated (NQ)
4293 846.4190 2536.2352 2536.2809 -18.0 1 2 2.8 +1Score > 19 indicates identity GTIAEDLNDGLTGGFKGDNFLLIR + Deamidated (NQ)
3708 859.8958 1717.7770 1717.7876 -6.12 1 2 1.3 +1Score > 16 indicates identity SMQLLAEDRTDHMR + Oxidation (M)
4048 994.5131 1987.0116 1987.0053 3.19 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 ACTQPVLGICLGMQLLGR + Deamidated (NQ)
3088 558.7726 1115.5306 1115.5281 2.29 0 2 1.9 +1Score > 17 indicates identity VADDAPLMER
2869 323.4953 967.4641 967.4471 17.5 0 2 2 +1Score > 18 indicates identity ANIGHGDQR + Deamidated (NQ)
3995 488.2444 1948.9485 1948.9247 12.2 1 2 0.99 +1Score > 20 indicates identity
Score > 15 indicates homology		 SDNMIADTVFRMIGHAR + Oxidation (M)
4089 672.3393 2013.9961 2014.0346 -19.1 0 2 2.5 +1Score > 19 indicates identity IATPLGPLWVICDEQFR
3213 629.2761 1256.5376 1256.5244 10.5 0 2 0.81 +1Score > 14 indicates identity SWDACVNSYR
3212 628.3652 1254.7158 1254.7044 9.13 1 2 1.2 +1Score > 15 indicates identity ERQAIEQLIR
2977 515.3040 1028.5934 1028.5978 -4.27 0 2 1.8 +1Score > 17 indicates identity LVLTTQAQR
3946 954.4411 1906.8676 1906.8771 -4.96 0 2 2.2 +1Score > 18 indicates identity IAFLFTGQGSQYVNMGR + 3 Deamidated (NQ); Oxidation (M)
4021 659.6807 1976.0203 1976.0288 -4.32 1 2 3 +1Score > 19 indicates identity MNLAIQILASYPPSGKEK + Deamidated (NQ); Oxidation (M)
4115 678.6910 2033.0512 2033.0326 9.15 0 2 2.2 +1Score > 18 indicates identity VLMQDFTGVPAVVDLAAMR + Deamidated (NQ)
2936 502.2544 1002.4942 1002.5094 -15.1 1 2 3.1 +1Score > 19 indicates identity DRDQTLVR + Deamidated (NQ)
4078 670.6853 2009.0341 2009.0694 -17.6 1 2 2.8 +1Score > 19 indicates identity RDNLEISPNLWAGVGLVR + Deamidated (NQ)
3892 617.6649 1849.9729 1849.9549 9.72 0 2 2.2 +1Score > 18 indicates identity AFTNYLPGFNIPMLPR
3969 967.9380 1933.8614 1933.8298 16.3 1 2 1.6 +1Score > 16 indicates identity QSMGFDTNMEGGFLARR + 2 Deamidated (NQ); Oxidation (M)
2636 360.7067 719.3988 719.3966 3.09 0 2 1.9 +1Score > 17 indicates identity GEVLFR
2897 985.4759 984.4686 984.4665 2.18 0 2 1.3 +1Score > 15 indicates identity GTYPAYSAR
4170 701.3167 2100.9283 2100.8887 18.8 1 2 1.4 +1Score > 16 indicates identity EWYFANNYIYDMGRNK + 2 Deamidated (NQ); Oxidation (M)
3439 345.4383 1377.7241 1377.7252 -0.79 0 2 2.3 +1Score > 18 indicates identity KPDHQLAALQEK + Deamidated (NQ)
4095 673.0226 2016.0460 2016.0105 17.6 1 2 2.5 +1Score > 18 indicates identity SPLYQKQFYQPFINSR + Deamidated (NQ)
2957 507.7613 1013.5080 1013.5142 -6.03 0 2 1.7 +1Score > 17 indicates identity LPGELSGGQR + Deamidated (NQ)
4110 1016.5120 2031.0094 2031.0459 -17.9 0 2 3.1 +1Score > 19 indicates identity NVGDRPLLWSTLGQSLMK + Deamidated (NQ); Oxidation (M)
2892 492.7156 983.4166 983.4165 0.19 0 2 0.67 +1Score > 13 indicates identity TTCSLCSR
4455 1062.1829 3183.5269 3183.5191 2.44 1 2 3 +1Score > 19 indicates identity IAATMENAQKGEIMPNIPQMSAFWYAVR + Deamidated (NQ); Oxidation (M)
Page: Previous 1 2 3 4 5 6 7 8 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/