MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1249__1.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues)
Timestamp : 23 Jun 2025 at 17:44:49 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,592

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4271)


Page: Previous 1 2 3 4 5 6 7  43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2637 720.4064 719.3991 719.3966 3.48 0 8 0.5 +1Score > 17 indicates identity FDALVR
3053 540.7383 1079.4620 1079.4739 -11.0 0 7 0.26 +1Score > 14 indicates identity EDMSMQAIR
3154 603.3068 1204.5990 1204.5870 9.98 1 7 0.77 +1Score > 20 indicates identity
Score > 19 indicates homology
DRDLIGMVDR + Oxidation (M)
2809 930.5289 929.5216 929.5182 3.71 0 7 0.68 +1Score > 18 indicates identity IITQADLR + Deamidated (NQ)
3167 307.3943 1225.5481 1225.5397 6.84 0 7 0.31 +1Score > 15 indicates identity MEQYDQIGAR + Oxidation (M)
3347 669.3583 1336.7020 1336.7099 -5.85 1 7 0.72 +1Score > 18 indicates identity SPSAQKLEALHR + Deamidated (NQ)
3674 555.9612 1664.8618 1664.8774 -9.36 1 7 0.72 +1Score > 18 indicates identity AQVAIFKEIFDQVR + 2 Deamidated (NQ)
3095 562.7937 1123.5728 1123.5734 -0.49 1 7 0.64 +1Score > 18 indicates identity QAQELHDKR
2650 365.2353 728.4560 728.4545 2.19 0 7 0.68 +1Score > 18 indicates identity SVAIALR
3105 572.7747 1143.5348 1143.5421 -6.34 1 7 0.38 +1Score > 15 indicates identity HTTRNFPNR + 2 Deamidated (NQ)
3198 624.3000 1246.5854 1246.5830 1.97 0 7 0.71 +1Score > 18 indicates identity DDIFSVPSPDR
3498 702.8515 1403.6884 1403.6980 -6.77 1 7 0.87 +1Score > 19 indicates identity RLMTASWPGNVR + Deamidated (NQ); Oxidation (M)
3451 345.9427 1379.7417 1379.7483 -4.77 0 7 0.44 +1Score > 16 indicates identity IIFCGTLTAGSLK
2589 346.6735 691.3324 691.3323 0.23 0 7 0.78 +1Score > 18 indicates identity MAGLER + Oxidation (M)
2973 513.7328 1025.4510 1025.4600 -8.74 0 7 0.35 +1Score > 15 indicates identity ISQYACQR + Deamidated (NQ)
4107 677.6769 2030.0089 2030.0221 -6.52 1 7 1 +1Score > 19 indicates identity RDWQLQQLGITQWSLR + 3 Deamidated (NQ)
2861 479.2629 956.5112 956.5291 -18.6 0 7 0.94 +1Score > 19 indicates identity QDILEAIR
3756 438.9861 1751.9153 1751.8916 13.5 0 7 0.69 +1Score > 18 indicates identity LVPGYEAPVMLAYSAR + Oxidation (M)
3461 694.8694 1387.7242 1387.7030 15.3 1 7 0.92 +1Score > 19 indicates identity RLMTASWPGNVR + Deamidated (NQ)
3567 721.8608 1441.7070 1441.7201 -9.07 0 7 0.5 +1Score > 16 indicates identity FHAQPLSANDTLK + Deamidated (NQ)
3268 643.3051 1284.5956 1284.5955 0.15 0 7 0.48 +1Score > 16 indicates identity MVTNLYQNMR + Oxidation (M)
3166 613.2924 1224.5702 1224.5809 -8.68 0 7 0.55 +1Score > 17 indicates identity GVFNMLLSDGR + Deamidated (NQ); Oxidation (M)
2712 418.7062 835.3978 835.3970 0.99 1 7 0.69 +1Score > 17 indicates identity GRMESTR
3235 423.5175 1267.5307 1267.5537 -18.1 1 7 0.33 +1Score > 14 indicates identity DAAMVADMREK + 2 Oxidation (M)
2958 507.7693 1013.5240 1013.5182 5.78 0 7 0.72 +1Score > 18 indicates identity GTYFLGSAAK
3149 601.8015 1201.5884 1201.5938 -4.48 1 7 1.1 +1Score > 19 indicates identity AEQAALQADKR + 2 Deamidated (NQ)
3772 440.2390 1756.9269 1756.9472 -11.5 1 7 0.86 +1Score > 18 indicates identity LTDSFRGISVIPAEPR
3667 546.9741 1637.9005 1637.8736 16.4 0 6 0.4 +1Score > 15 indicates identity ALGAKPQINAEEEIR
2654 732.3300 731.3227 731.3198 3.99 0 6 0.23 +1Score > 13 indicates identity NQEGQR + Deamidated (NQ)
2688 397.2400 792.4654 792.4606 6.12 1 6 0.25 +1Score > 13 indicates identity SLRVYR
3298 654.3102 1306.6058 1306.6261 -15.5 0 6 0.61 +1Score > 17 indicates identity ELALLMSDAGCK
2521 324.1742 646.3338 646.3221 18.2 0 6 0.95 +1Score > 19 indicates identity AAACVR
4227 806.7575 2417.2507 2417.2173 13.8 0 6 0.69 +1Score > 17 indicates identity LQTLGLTQGTVVTISAEGEDEQK + Deamidated (NQ)
2576 684.3632 683.3559 683.3602 -6.28 0 6 0.34 +1Score > 14 indicates identity IPSNPR + Deamidated (NQ)
3927 471.4743 1881.8681 1881.8719 -2.04 1 6 0.98 +1Score > 19 indicates identity FAFQNARAFEYLMTR + 2 Deamidated (NQ); Oxidation (M)
3259 640.3384 1278.6622 1278.6390 18.2 1 6 1 +1Score > 19 indicates identity KAFQDMEAALR
2496 315.1700 628.3254 628.3367 -17.8 0 6 0.58 +1Score > 16 indicates identity HMTIK
4125 409.4007 2041.9671 2042.0004 -16.3 1 6 0.5 +1Score > 20 indicates identity
Score > 16 indicates homology
HTNWQVCSLVVQAKSER + Deamidated (NQ)
2841 317.8344 950.4814 950.4855 -4.35 1 6 0.84 +1Score > 18 indicates identity RMLVSSDK + Oxidation (M)
3797 593.5760 1777.7062 1777.6962 5.62 0 6 0.25 +1Score > 13 indicates identity GNGENSYGGNGDMTYAR + Oxidation (M)
4356 654.0585 2612.2049 2612.2329 -10.7 1 6 0.95 +1Score > 18 indicates identity IWDFNGGIHPPEMKTQSNGTPLR + 2 Deamidated (NQ); Oxidation (M)
2939 502.2814 1002.5482 1002.5345 13.7 1 6 0.96 +1Score > 18 indicates identity IQSIEEKR + Deamidated (NQ)
4587 949.2273 5689.3201 5689.2571 11.1 1 6 0.26 +1Score > 13 indicates identity HSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALLSSLLALER
2398 529.2751 528.2678 528.2656 4.22 0 6 0.27 +1Score > 13 indicates identity AGPQR + Deamidated (NQ)
3040 535.7625 1069.5104 1069.5001 9.65 0 6 0.53 +1Score > 16 indicates identity LYELEMQK + Deamidated (NQ); Oxidation (M)
3291 651.3010 1300.5874 1300.6122 -19.0 0 6 0.51 +1Score > 15 indicates identity MFNTAFDALGAK + Oxidation (M)
3440 345.4384 1377.7245 1377.7252 -0.50 0 6 0.97 +1Score > 18 indicates identity KPDHQLAALQEK + Deamidated (NQ)
2703 822.4569 821.4496 821.4508 -1.38 1 6 0.55 +1Score > 16 indicates identity QRLSYR
2880 491.2019 980.3892 980.4055 -16.6 0 6 0.28 +1Score > 13 indicates identity MEMTNAQR + Deamidated (NQ)
4458 1112.2657 3333.7753 3333.8169 -12.5 0 6 0.53 +1Score > 15 indicates identity LIPQMNYLMVVVALFFLNAVIFLFMLMK + Oxidation (M)
4374 658.3153 2629.2321 2629.2368 -1.80 1 6 1.2 +1Score > 19 indicates identity TTEQSWQQQTRTSQAAPVQAQPR + 3 Deamidated (NQ)
4032 659.6848 1976.0326 1976.0075 12.7 1 5 1.3 +1Score > 19 indicates identity EPRANTQAAEHILQEIR + Deamidated (NQ)
2604 700.3660 699.3587 699.3664 -10.9 0 5 0.43 +1Score > 14 indicates identity SLNPNR
2883 328.1480 981.4222 981.4039 18.6 0 5 0.41 +1Score > 14 indicates identity NPYEESSR + Deamidated (NQ)
3371 451.2219 1350.6439 1350.6602 -12.1 0 5 0.95 +1Score > 18 indicates identity NNVLSGLFCGLR + 2 Deamidated (NQ)
3520 474.5963 1420.7671 1420.7674 -0.23 1 5 0.62 +1Score > 16 indicates identity YQQLAKTNLVSR + Deamidated (NQ)
2764 452.7305 903.4464 903.4297 18.5 1 5 1.5 +1Score > 19 indicates identity DNQQIKR + 3 Deamidated (NQ)
3460 694.8677 1387.7208 1387.7030 12.8 1 5 1.3 +1Score > 19 indicates identity RLMTASWPGNVR + Deamidated (NQ)
2859 478.7428 955.4710 955.4763 -5.52 0 5 0.43 +1Score > 14 indicates identity IASSFFQR + Deamidated (NQ)
3851 365.9889 1824.9081 1824.9152 -3.88 1 5 1.4 +1Score > 19 indicates identity SVNALMTATYQEIGRR + Oxidation (M)
4131 410.4030 2046.9786 2046.9761 1.22 1 5 1.3 +1Score > 19 indicates identity ENIMNNPVIGVVMCRNR + 2 Oxidation (M)
3480 697.8772 1393.7398 1393.7565 -12.0 1 5 0.8 +1Score > 16 indicates identity GAVPDAVADPNLKK
3416 341.9447 1363.7497 1363.7473 1.76 1 5 0.44 +1Score > 14 indicates identity FRHGIAIAGTHGK
3008 523.2681 1044.5216 1044.5200 1.62 1 5 1.3 +1Score > 19 indicates identity QDEQEIKR
3482 465.9085 1394.7037 1394.6929 7.70 0 5 1.1 +1Score > 18 indicates identity DVVTSYAQAVDVK + Deamidated (NQ)
3683 564.3036 1689.8890 1689.8897 -0.45 1 5 1.3 +1Score > 19 indicates identity ADTTIISSGSRQVVEK
3968 645.3041 1932.8905 1932.9152 -12.8 1 5 1.1 +1Score > 18 indicates identity MSTPDNRSVNFFSLFR + Oxidation (M)
3170 409.8674 1226.5804 1226.5640 13.4 1 5 1 +1Score > 17 indicates identity RTTGNNNGGVHV + 2 Deamidated (NQ)
3143 601.3092 1200.6038 1200.6172 -11.1 1 5 1.6 +1Score > 19 indicates identity EAKIMDPQIR + Deamidated (NQ)
4047 663.3436 1987.0090 1986.9799 14.6 0 5 1 +1Score > 20 indicates identity
Score > 17 indicates homology
HYPLEADNIFAAIAATNR + Deamidated (NQ)
3497 351.9293 1403.6881 1403.6681 14.3 0 5 1.5 +1Score > 19 indicates identity ELAYNAPGNQGLR + 2 Deamidated (NQ)
2702 822.4537 821.4464 821.4508 -5.28 1 5 0.59 +1Score > 15 indicates identity QRLSYR
3496 468.9029 1403.6869 1403.6868 0.085 0 5 1.5 +1Score > 19 indicates identity IIPFSCVDGPGSR
2700 822.4532 821.4459 821.4508 -5.89 1 5 0.62 +1Score > 15 indicates identity QRLSYR
2427 543.3630 542.3557 542.3540 3.17 0 4 1.5 +1Score > 19 indicates identity AAIIR
3200 418.2061 1251.5965 1251.6207 -19.4 0 4 1.2 +1Score > 18 indicates identity ANQLAELAHQR + 2 Deamidated (NQ)
2994 519.7467 1037.4788 1037.4746 4.07 1 4 0.93 +1Score > 17 indicates identity RGDMLMQR + 2 Oxidation (M)
2590 346.6737 691.3328 691.3323 0.81 0 4 1.4 +1Score > 18 indicates identity GMLEAR + Oxidation (M)
3822 901.4689 1800.9232 1800.9516 -15.7 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
VSAMPSTQQEVLRLSR
3043 537.2864 1072.5582 1072.5625 -3.96 1 4 0.94 +1Score > 20 indicates identity
Score > 17 indicates homology
LSRSQPTER
2689 400.2077 798.4008 798.4137 -16.0 1 4 0.52 +1Score > 14 indicates identity FSRYAR
2593 693.3485 692.3412 692.3275 19.8 1 4 0.93 +1Score > 16 indicates identity MNREK + Oxidation (M)
2540 331.1763 660.3380 660.3377 0.47 0 4 1.2 +1Score > 17 indicates identity VQCVR
4413 924.1365 2769.3877 2769.4218 -12.3 0 4 1.8 +1Score > 19 indicates identity IMDLQSAQQLGEIAAAVGLAQNLGALR + 3 Deamidated (NQ); Oxidation (M)
3522 474.9306 1421.7700 1421.7449 17.6 1 4 0.92 +1Score > 16 indicates identity VYAVKMNGQTVGR
3339 443.8980 1328.6722 1328.6738 -1.20 1 4 1.5 +1Score > 18 indicates identity YQKINAHHYR
4313 640.8355 2559.3129 2559.3189 -2.36 0 4 1.7 +1Score > 19 indicates identity AFNAEAGPLIAVCMGVITGVGGGIIR + Deamidated (NQ); Oxidation (M)
2955 338.1848 1011.5326 1011.5324 0.19 0 4 0.69 +1Score > 15 indicates identity AAMAWLPPR
3931 630.9647 1889.8723 1889.9022 -15.8 0 4 1.3 +1Score > 18 indicates identity YIEIWNIVFMQFNR + 2 Deamidated (NQ); Oxidation (M)
2741 440.2338 878.4530 878.4610 -9.05 1 4 1.4 +1Score > 18 indicates identity PSTRYQK
3488 349.9410 1395.7349 1395.7146 14.5 1 4 1.1 +1Score > 17 indicates identity RYYSLTTHNLK + Deamidated (NQ)
3684 565.9932 1694.9578 1694.9679 -5.95 0 4 0.61 +1Score > 14 indicates identity LLANRPESALAVTLAR + Deamidated (NQ)
3770 878.4444 1754.8742 1754.8801 -3.31 0 4 1.5 +1Score > 18 indicates identity QSVFLYQLAVQTMPK + 3 Deamidated (NQ)
4042 990.9996 1979.9846 1979.9476 18.7 0 4 1.7 +1Score > 19 indicates identity ISDLNYSQHITLADNFK + 2 Deamidated (NQ)
3699 857.9944 1713.9742 1713.9625 6.87 1 4 0.49 +1Score > 13 indicates identity GVELLSTGGTARLLAEK
4265 618.8288 2471.2861 2471.2656 8.30 1 4 1.3 +1Score > 17 indicates identity VTLEIEQRYNHIPDTSSLSIR + Deamidated (NQ)
2428 543.3635 542.3562 542.3540 4.09 0 4 1.7 +1Score > 19 indicates identity AAIIR
3201 418.2130 1251.6172 1251.6208 -2.87 0 4 1.7 +1Score > 19 indicates identity GSGIHVVSNQPR + 2 Deamidated (NQ)
4151 689.3563 2065.0471 2065.0877 -19.7 1 4 1.6 +1Score > 18 indicates identity RDAMQSLLLPPPAQQALAK + 2 Deamidated (NQ); Oxidation (M)
2552 670.4264 669.4191 669.4173 2.66 0 4 0.42 +1Score > 13 indicates identity ATPLIR
Page: Previous 1 2 3 4 5 6 7  43 Next 

Not what you expected? Try the select summary.