MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1249__1.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,898 sequences; 1,660,463 residues) |
| Timestamp | : | 23 Jun 2025 at 17:44:49 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,592 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2637 |
720.4064 | 719.3991 | 719.3966 | 3.48 | 0 | 8 | 0.5 | 1Score > 17 indicates identity |
FDALVR |
| 3053 |
540.7383 | 1079.4620 | 1079.4739 | -11.0 | 0 | 7 | 0.26 | 1Score > 14 indicates identity |
EDMSMQAIR |
| 3154 |
603.3068 | 1204.5990 | 1204.5870 | 9.98 | 1 | 7 | 0.77 | 1Score > 20 indicates identity Score > 19 indicates homology |
DRDLIGMVDR + Oxidation (M) |
| 2809 |
930.5289 | 929.5216 | 929.5182 | 3.71 | 0 | 7 | 0.68 | 1Score > 18 indicates identity |
IITQADLR + Deamidated (NQ) |
| 3167 |
307.3943 | 1225.5481 | 1225.5397 | 6.84 | 0 | 7 | 0.31 | 1Score > 15 indicates identity |
MEQYDQIGAR + Oxidation (M) |
| 3347 |
669.3583 | 1336.7020 | 1336.7099 | -5.85 | 1 | 7 | 0.72 | 1Score > 18 indicates identity |
SPSAQKLEALHR + Deamidated (NQ) |
| 3674 |
555.9612 | 1664.8618 | 1664.8774 | -9.36 | 1 | 7 | 0.72 | 1Score > 18 indicates identity |
AQVAIFKEIFDQVR + 2 Deamidated (NQ) |
| 3095 |
562.7937 | 1123.5728 | 1123.5734 | -0.49 | 1 | 7 | 0.64 | 1Score > 18 indicates identity |
QAQELHDKR |
| 2650 |
365.2353 | 728.4560 | 728.4545 | 2.19 | 0 | 7 | 0.68 | 1Score > 18 indicates identity |
SVAIALR |
| 3105 |
572.7747 | 1143.5348 | 1143.5421 | -6.34 | 1 | 7 | 0.38 | 1Score > 15 indicates identity |
HTTRNFPNR + 2 Deamidated (NQ) |
| 3198 |
624.3000 | 1246.5854 | 1246.5830 | 1.97 | 0 | 7 | 0.71 | 1Score > 18 indicates identity |
DDIFSVPSPDR |
| 3498 |
702.8515 | 1403.6884 | 1403.6980 | -6.77 | 1 | 7 | 0.87 | 1Score > 19 indicates identity |
RLMTASWPGNVR + Deamidated (NQ); Oxidation (M) |
| 3451 |
345.9427 | 1379.7417 | 1379.7483 | -4.77 | 0 | 7 | 0.44 | 1Score > 16 indicates identity |
IIFCGTLTAGSLK |
| 2589 |
346.6735 | 691.3324 | 691.3323 | 0.23 | 0 | 7 | 0.78 | 1Score > 18 indicates identity |
MAGLER + Oxidation (M) |
| 2973 |
513.7328 | 1025.4510 | 1025.4600 | -8.74 | 0 | 7 | 0.35 | 1Score > 15 indicates identity |
ISQYACQR + Deamidated (NQ) |
| 4107 |
677.6769 | 2030.0089 | 2030.0221 | -6.52 | 1 | 7 | 1 | 1Score > 19 indicates identity |
RDWQLQQLGITQWSLR + 3 Deamidated (NQ) |
| 2861 |
479.2629 | 956.5112 | 956.5291 | -18.6 | 0 | 7 | 0.94 | 1Score > 19 indicates identity |
QDILEAIR |
| 3756 |
438.9861 | 1751.9153 | 1751.8916 | 13.5 | 0 | 7 | 0.69 | 1Score > 18 indicates identity |
LVPGYEAPVMLAYSAR + Oxidation (M) |
| 3461 |
694.8694 | 1387.7242 | 1387.7030 | 15.3 | 1 | 7 | 0.92 | 1Score > 19 indicates identity |
RLMTASWPGNVR + Deamidated (NQ) |
| 3567 |
721.8608 | 1441.7070 | 1441.7201 | -9.07 | 0 | 7 | 0.5 | 1Score > 16 indicates identity |
FHAQPLSANDTLK + Deamidated (NQ) |
| 3268 |
643.3051 | 1284.5956 | 1284.5955 | 0.15 | 0 | 7 | 0.48 | 1Score > 16 indicates identity |
MVTNLYQNMR + Oxidation (M) |
| 3166 |
613.2924 | 1224.5702 | 1224.5809 | -8.68 | 0 | 7 | 0.55 | 1Score > 17 indicates identity |
GVFNMLLSDGR + Deamidated (NQ); Oxidation (M) |
| 2712 |
418.7062 | 835.3978 | 835.3970 | 0.99 | 1 | 7 | 0.69 | 1Score > 17 indicates identity |
GRMESTR |
| 3235 |
423.5175 | 1267.5307 | 1267.5537 | -18.1 | 1 | 7 | 0.33 | 1Score > 14 indicates identity |
DAAMVADMREK + 2 Oxidation (M) |
| 2958 |
507.7693 | 1013.5240 | 1013.5182 | 5.78 | 0 | 7 | 0.72 | 1Score > 18 indicates identity |
GTYFLGSAAK |
| 3149 |
601.8015 | 1201.5884 | 1201.5938 | -4.48 | 1 | 7 | 1.1 | 1Score > 19 indicates identity |
AEQAALQADKR + 2 Deamidated (NQ) |
| 3772 |
440.2390 | 1756.9269 | 1756.9472 | -11.5 | 1 | 7 | 0.86 | 1Score > 18 indicates identity |
LTDSFRGISVIPAEPR |
| 3667 |
546.9741 | 1637.9005 | 1637.8736 | 16.4 | 0 | 6 | 0.4 | 1Score > 15 indicates identity |
ALGAKPQINAEEEIR |
| 2654 |
732.3300 | 731.3227 | 731.3198 | 3.99 | 0 | 6 | 0.23 | 1Score > 13 indicates identity |
NQEGQR + Deamidated (NQ) |
| 2688 |
397.2400 | 792.4654 | 792.4606 | 6.12 | 1 | 6 | 0.25 | 1Score > 13 indicates identity |
SLRVYR |
| 3298 |
654.3102 | 1306.6058 | 1306.6261 | -15.5 | 0 | 6 | 0.61 | 1Score > 17 indicates identity |
ELALLMSDAGCK |
| 2521 |
324.1742 | 646.3338 | 646.3221 | 18.2 | 0 | 6 | 0.95 | 1Score > 19 indicates identity |
AAACVR |
| 4227 |
806.7575 | 2417.2507 | 2417.2173 | 13.8 | 0 | 6 | 0.69 | 1Score > 17 indicates identity |
LQTLGLTQGTVVTISAEGEDEQK + Deamidated (NQ) |
| 2576 |
684.3632 | 683.3559 | 683.3602 | -6.28 | 0 | 6 | 0.34 | 1Score > 14 indicates identity |
IPSNPR + Deamidated (NQ) |
| 3927 |
471.4743 | 1881.8681 | 1881.8719 | -2.04 | 1 | 6 | 0.98 | 1Score > 19 indicates identity |
FAFQNARAFEYLMTR + 2 Deamidated (NQ); Oxidation (M) |
| 3259 |
640.3384 | 1278.6622 | 1278.6390 | 18.2 | 1 | 6 | 1 | 1Score > 19 indicates identity |
KAFQDMEAALR |
| 2496 |
315.1700 | 628.3254 | 628.3367 | -17.8 | 0 | 6 | 0.58 | 1Score > 16 indicates identity |
HMTIK |
| 4125 |
409.4007 | 2041.9671 | 2042.0004 | -16.3 | 1 | 6 | 0.5 | 1Score > 20 indicates identity Score > 16 indicates homology |
HTNWQVCSLVVQAKSER + Deamidated (NQ) |
| 2841 |
317.8344 | 950.4814 | 950.4855 | -4.35 | 1 | 6 | 0.84 | 1Score > 18 indicates identity |
RMLVSSDK + Oxidation (M) |
| 3797 |
593.5760 | 1777.7062 | 1777.6962 | 5.62 | 0 | 6 | 0.25 | 1Score > 13 indicates identity |
GNGENSYGGNGDMTYAR + Oxidation (M) |
| 4356 |
654.0585 | 2612.2049 | 2612.2329 | -10.7 | 1 | 6 | 0.95 | 1Score > 18 indicates identity |
IWDFNGGIHPPEMKTQSNGTPLR + 2 Deamidated (NQ); Oxidation (M) |
| 2939 |
502.2814 | 1002.5482 | 1002.5345 | 13.7 | 1 | 6 | 0.96 | 1Score > 18 indicates identity |
IQSIEEKR + Deamidated (NQ) |
| 4587 |
949.2273 | 5689.3201 | 5689.2571 | 11.1 | 1 | 6 | 0.26 | 1Score > 13 indicates identity |
HSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALLSSLLALER |
| 2398 |
529.2751 | 528.2678 | 528.2656 | 4.22 | 0 | 6 | 0.27 | 1Score > 13 indicates identity |
AGPQR + Deamidated (NQ) |
| 3040 |
535.7625 | 1069.5104 | 1069.5001 | 9.65 | 0 | 6 | 0.53 | 1Score > 16 indicates identity |
LYELEMQK + Deamidated (NQ); Oxidation (M) |
| 3291 |
651.3010 | 1300.5874 | 1300.6122 | -19.0 | 0 | 6 | 0.51 | 1Score > 15 indicates identity |
MFNTAFDALGAK + Oxidation (M) |
| 3440 |
345.4384 | 1377.7245 | 1377.7252 | -0.50 | 0 | 6 | 0.97 | 1Score > 18 indicates identity |
KPDHQLAALQEK + Deamidated (NQ) |
| 2703 |
822.4569 | 821.4496 | 821.4508 | -1.38 | 1 | 6 | 0.55 | 1Score > 16 indicates identity |
QRLSYR |
| 2880 |
491.2019 | 980.3892 | 980.4055 | -16.6 | 0 | 6 | 0.28 | 1Score > 13 indicates identity |
MEMTNAQR + Deamidated (NQ) |
| 4458 |
1112.2657 | 3333.7753 | 3333.8169 | -12.5 | 0 | 6 | 0.53 | 1Score > 15 indicates identity |
LIPQMNYLMVVVALFFLNAVIFLFMLMK + Oxidation (M) |
| 4374 |
658.3153 | 2629.2321 | 2629.2368 | -1.80 | 1 | 6 | 1.2 | 1Score > 19 indicates identity |
TTEQSWQQQTRTSQAAPVQAQPR + 3 Deamidated (NQ) |
| 4032 |
659.6848 | 1976.0326 | 1976.0075 | 12.7 | 1 | 5 | 1.3 | 1Score > 19 indicates identity |
EPRANTQAAEHILQEIR + Deamidated (NQ) |
| 2604 |
700.3660 | 699.3587 | 699.3664 | -10.9 | 0 | 5 | 0.43 | 1Score > 14 indicates identity |
SLNPNR |
| 2883 |
328.1480 | 981.4222 | 981.4039 | 18.6 | 0 | 5 | 0.41 | 1Score > 14 indicates identity |
NPYEESSR + Deamidated (NQ) |
| 3371 |
451.2219 | 1350.6439 | 1350.6602 | -12.1 | 0 | 5 | 0.95 | 1Score > 18 indicates identity |
NNVLSGLFCGLR + 2 Deamidated (NQ) |
| 3520 |
474.5963 | 1420.7671 | 1420.7674 | -0.23 | 1 | 5 | 0.62 | 1Score > 16 indicates identity |
YQQLAKTNLVSR + Deamidated (NQ) |
| 2764 |
452.7305 | 903.4464 | 903.4297 | 18.5 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
DNQQIKR + 3 Deamidated (NQ) |
| 3460 |
694.8677 | 1387.7208 | 1387.7030 | 12.8 | 1 | 5 | 1.3 | 1Score > 19 indicates identity |
RLMTASWPGNVR + Deamidated (NQ) |
| 2859 |
478.7428 | 955.4710 | 955.4763 | -5.52 | 0 | 5 | 0.43 | 1Score > 14 indicates identity |
IASSFFQR + Deamidated (NQ) |
| 3851 |
365.9889 | 1824.9081 | 1824.9152 | -3.88 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
SVNALMTATYQEIGRR + Oxidation (M) |
| 4131 |
410.4030 | 2046.9786 | 2046.9761 | 1.22 | 1 | 5 | 1.3 | 1Score > 19 indicates identity |
ENIMNNPVIGVVMCRNR + 2 Oxidation (M) |
| 3480 |
697.8772 | 1393.7398 | 1393.7565 | -12.0 | 1 | 5 | 0.8 | 1Score > 16 indicates identity |
GAVPDAVADPNLKK |
| 3416 |
341.9447 | 1363.7497 | 1363.7473 | 1.76 | 1 | 5 | 0.44 | 1Score > 14 indicates identity |
FRHGIAIAGTHGK |
| 3008 |
523.2681 | 1044.5216 | 1044.5200 | 1.62 | 1 | 5 | 1.3 | 1Score > 19 indicates identity |
QDEQEIKR |
| 3482 |
465.9085 | 1394.7037 | 1394.6929 | 7.70 | 0 | 5 | 1.1 | 1Score > 18 indicates identity |
DVVTSYAQAVDVK + Deamidated (NQ) |
| 3683 |
564.3036 | 1689.8890 | 1689.8897 | -0.45 | 1 | 5 | 1.3 | 1Score > 19 indicates identity |
ADTTIISSGSRQVVEK |
| 3968 |
645.3041 | 1932.8905 | 1932.9152 | -12.8 | 1 | 5 | 1.1 | 1Score > 18 indicates identity |
MSTPDNRSVNFFSLFR + Oxidation (M) |
| 3170 |
409.8674 | 1226.5804 | 1226.5640 | 13.4 | 1 | 5 | 1 | 1Score > 17 indicates identity |
RTTGNNNGGVHV + 2 Deamidated (NQ) |
| 3143 |
601.3092 | 1200.6038 | 1200.6172 | -11.1 | 1 | 5 | 1.6 | 1Score > 19 indicates identity |
EAKIMDPQIR + Deamidated (NQ) |
| 4047 |
663.3436 | 1987.0090 | 1986.9799 | 14.6 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
HYPLEADNIFAAIAATNR + Deamidated (NQ) |
| 3497 |
351.9293 | 1403.6881 | 1403.6681 | 14.3 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
ELAYNAPGNQGLR + 2 Deamidated (NQ) |
| 2702 |
822.4537 | 821.4464 | 821.4508 | -5.28 | 1 | 5 | 0.59 | 1Score > 15 indicates identity |
QRLSYR |
| 3496 |
468.9029 | 1403.6869 | 1403.6868 | 0.085 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
IIPFSCVDGPGSR |
| 2700 |
822.4532 | 821.4459 | 821.4508 | -5.89 | 1 | 5 | 0.62 | 1Score > 15 indicates identity |
QRLSYR |
| 2427 |
543.3630 | 542.3557 | 542.3540 | 3.17 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
AAIIR |
| 3200 |
418.2061 | 1251.5965 | 1251.6207 | -19.4 | 0 | 4 | 1.2 | 1Score > 18 indicates identity |
ANQLAELAHQR + 2 Deamidated (NQ) |
| 2994 |
519.7467 | 1037.4788 | 1037.4746 | 4.07 | 1 | 4 | 0.93 | 1Score > 17 indicates identity |
RGDMLMQR + 2 Oxidation (M) |
| 2590 |
346.6737 | 691.3328 | 691.3323 | 0.81 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
GMLEAR + Oxidation (M) |
| 3822 |
901.4689 | 1800.9232 | 1800.9516 | -15.7 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
VSAMPSTQQEVLRLSR |
| 3043 |
537.2864 | 1072.5582 | 1072.5625 | -3.96 | 1 | 4 | 0.94 | 1Score > 20 indicates identity Score > 17 indicates homology |
LSRSQPTER |
| 2689 |
400.2077 | 798.4008 | 798.4137 | -16.0 | 1 | 4 | 0.52 | 1Score > 14 indicates identity |
FSRYAR |
| 2593 |
693.3485 | 692.3412 | 692.3275 | 19.8 | 1 | 4 | 0.93 | 1Score > 16 indicates identity |
MNREK + Oxidation (M) |
| 2540 |
331.1763 | 660.3380 | 660.3377 | 0.47 | 0 | 4 | 1.2 | 1Score > 17 indicates identity |
VQCVR |
| 4413 |
924.1365 | 2769.3877 | 2769.4218 | -12.3 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
IMDLQSAQQLGEIAAAVGLAQNLGALR + 3 Deamidated (NQ); Oxidation (M) |
| 3522 |
474.9306 | 1421.7700 | 1421.7449 | 17.6 | 1 | 4 | 0.92 | 1Score > 16 indicates identity |
VYAVKMNGQTVGR |
| 3339 |
443.8980 | 1328.6722 | 1328.6738 | -1.20 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
YQKINAHHYR |
| 4313 |
640.8355 | 2559.3129 | 2559.3189 | -2.36 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
AFNAEAGPLIAVCMGVITGVGGGIIR + Deamidated (NQ); Oxidation (M) |
| 2955 |
338.1848 | 1011.5326 | 1011.5324 | 0.19 | 0 | 4 | 0.69 | 1Score > 15 indicates identity |
AAMAWLPPR |
| 3931 |
630.9647 | 1889.8723 | 1889.9022 | -15.8 | 0 | 4 | 1.3 | 1Score > 18 indicates identity |
YIEIWNIVFMQFNR + 2 Deamidated (NQ); Oxidation (M) |
| 2741 |
440.2338 | 878.4530 | 878.4610 | -9.05 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
PSTRYQK |
| 3488 |
349.9410 | 1395.7349 | 1395.7146 | 14.5 | 1 | 4 | 1.1 | 1Score > 17 indicates identity |
RYYSLTTHNLK + Deamidated (NQ) |
| 3684 |
565.9932 | 1694.9578 | 1694.9679 | -5.95 | 0 | 4 | 0.61 | 1Score > 14 indicates identity |
LLANRPESALAVTLAR + Deamidated (NQ) |
| 3770 |
878.4444 | 1754.8742 | 1754.8801 | -3.31 | 0 | 4 | 1.5 | 1Score > 18 indicates identity |
QSVFLYQLAVQTMPK + 3 Deamidated (NQ) |
| 4042 |
990.9996 | 1979.9846 | 1979.9476 | 18.7 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
ISDLNYSQHITLADNFK + 2 Deamidated (NQ) |
| 3699 |
857.9944 | 1713.9742 | 1713.9625 | 6.87 | 1 | 4 | 0.49 | 1Score > 13 indicates identity |
GVELLSTGGTARLLAEK |
| 4265 |
618.8288 | 2471.2861 | 2471.2656 | 8.30 | 1 | 4 | 1.3 | 1Score > 17 indicates identity |
VTLEIEQRYNHIPDTSSLSIR + Deamidated (NQ) |
| 2428 |
543.3635 | 542.3562 | 542.3540 | 4.09 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
AAIIR |
| 3201 |
418.2130 | 1251.6172 | 1251.6208 | -2.87 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
GSGIHVVSNQPR + 2 Deamidated (NQ) |
| 4151 |
689.3563 | 2065.0471 | 2065.0877 | -19.7 | 1 | 4 | 1.6 | 1Score > 18 indicates identity |
RDAMQSLLLPPPAQQALAK + 2 Deamidated (NQ); Oxidation (M) |
| 2552 |
670.4264 | 669.4191 | 669.4173 | 2.66 | 0 | 4 | 0.42 | 1Score > 13 indicates identity |
ATPLIR |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/