MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 2 |
| MS data file | : | PRT1249__2.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,898 sequences; 1,660,429 residues) |
| Timestamp | : | 23 Jun 2025 at 17:08:04 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,602 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2555 |
510.7728 | 1019.5310 | 1019.5321 | -1.05 | 0 | 1 | 3.8 | 1Score > 19 indicates identity |
DMVLATLNK + Oxidation (M) |
| 3409 |
814.4247 | 1626.8348 | 1626.8366 | -1.05 | 1 | 1 | 3.3 | 1Score > 18 indicates identity |
LDQHGGFIRQVLDK + 2 Deamidated (NQ) |
| 3502 |
572.3325 | 1713.9757 | 1713.9600 | 9.17 | 1 | 1 | 1 | 1Score > 13 indicates identity |
ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M) |
| 4261 |
629.8366 | 2515.3173 | 2515.3138 | 1.38 | 1 | 1 | 2.8 | 1Score > 18 indicates identity |
RMISGEMDVVLVPQGTLIEQIR + 2 Oxidation (M) |
| 3091 |
342.1942 | 1364.7477 | 1364.7663 | -13.7 | 0 | 1 | 1.3 | 1Score > 14 indicates identity |
EIAHLTDKPTLK |
| 3853 |
644.0499 | 1929.1279 | 1929.1299 | -1.03 | 0 | 1 | 0.87 | 1Score > 13 indicates identity |
FLSALILLLVTTAAQAER |
| 4140 |
563.2704 | 2249.0525 | 2249.0851 | -14.5 | 1 | 1 | 3.5 | 1Score > 19 indicates identity |
QSNLVEKLESLQPGYNYHK + 3 Deamidated (NQ) |
| 3985 |
672.3401 | 2013.9985 | 2014.0346 | -17.9 | 0 | 1 | 3.8 | 1Score > 19 indicates identity |
IATPLGPLWVICDEQFR |
| 2825 |
311.1370 | 1240.5189 | 1240.5142 | 3.76 | 1 | 1 | 0.92 | 1Score > 13 indicates identity |
EFDRQMDER + Oxidation (M) |
| 2773 |
602.2943 | 1202.5740 | 1202.5891 | -12.5 | 1 | 1 | 3.7 | 1Score > 19 indicates identity |
EADVQTKQER |
| 3759 |
465.7369 | 1858.9185 | 1858.9346 | -8.66 | 1 | 1 | 4.4 | 1Score > 20 indicates identity |
AAGAELVGMEDLADQIKK + Deamidated (NQ) |
| 2288 |
415.2317 | 828.4488 | 828.4593 | -12.6 | 0 | 1 | 2.6 | 1Score > 17 indicates identity |
ITPLEEK |
| 2546 |
507.7619 | 1013.5092 | 1013.5142 | -4.85 | 0 | 1 | 2.5 | 1Score > 17 indicates identity |
LPGELSGGQR + Deamidated (NQ) |
| 2438 |
318.5052 | 952.4938 | 952.4800 | 14.4 | 1 | 1 | 2.5 | 1Score > 17 indicates identity |
FGGMKIER + Oxidation (M) |
| 3713 |
610.6468 | 1828.9186 | 1828.9108 | 4.27 | 1 | 1 | 4.1 | 1Score > 19 indicates identity |
WLDNEGKFRPENPVK + Deamidated (NQ) |
| 2676 |
558.7719 | 1115.5292 | 1115.5458 | -14.9 | 0 | 1 | 2.8 | 1Score > 17 indicates identity |
QIDDQLLNR + 2 Deamidated (NQ) |
| 2794 |
408.1989 | 1221.5749 | 1221.5989 | -19.7 | 1 | 1 | 3.5 | 1Score > 18 indicates identity |
QRSVFAEGAEK + Deamidated (NQ) |
| 3215 |
714.3691 | 1426.7236 | 1426.7092 | 10.1 | 0 | 1 | 3.9 | 1Score > 19 indicates identity |
LGIPDEALHNYGK + Deamidated (NQ) |
| 3497 |
572.3309 | 1713.9709 | 1713.9600 | 6.37 | 1 | 1 | 1.1 | 1Score > 13 indicates identity |
ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M) |
| 3138 |
463.5762 | 1387.7068 | 1387.6819 | 17.9 | 0 | 0 | 4.1 | 1Score > 19 indicates identity |
NWYLLICNHR |
| 2736 |
394.2086 | 1179.6040 | 1179.6261 | -18.8 | 1 | 0 | 2.9 | 1Score > 18 indicates identity |
DHRNWLALR |
| 3875 |
390.5961 | 1947.9441 | 1947.9547 | -5.41 | 0 | 0 | 4.1 | 1Score > 19 indicates identity |
AVVLAGLPDVFCAGAAMDR + Oxidation (M) |
| 3841 |
640.9741 | 1919.9005 | 1919.8968 | 1.90 | 0 | 0 | 3.6 | 1Score > 19 indicates identity |
DVRPPAELISSMNAQMK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 3141 |
694.8666 | 1387.7186 | 1387.7347 | -11.6 | 0 | 0 | 4.2 | 1Score > 19 indicates identity |
SALNNFLEPLLR + 2 Deamidated (NQ) |
| 2930 |
643.3619 | 1284.7092 | 1284.6939 | 12.0 | 0 | 0 | 3.1 | 1Score > 18 indicates identity |
LGGAGASAVGWALR |
| 3691 |
607.9953 | 1820.9641 | 1821.0004 | -20.0 | 1 | 0 | 3 | 1Score > 18 indicates identity |
HMELLAHSILKLICK + Oxidation (M) |
| 2749 |
595.3221 | 1188.6296 | 1188.6437 | -11.8 | 1 | 0 | 3.8 | 1Score > 19 indicates identity |
RWNMLLSLR + Deamidated (NQ) |
| 4365 |
900.7844 | 2699.3314 | 2699.3312 | 0.067 | 1 | 0 | 3.8 | 1Score > 19 indicates identity |
AMELCRPLPWIDDDKPRLGDFR |
| 3018 |
668.8227 | 1335.6308 | 1335.6531 | -16.7 | 1 | 0 | 3.6 | 1Score > 18 indicates identity |
QHNTLSKHNQK + 2 Deamidated (NQ) |
| 2677 |
372.8510 | 1115.5312 | 1115.5459 | -13.2 | 0 | 0 | 2.8 | 1Score > 17 indicates identity |
QLDDLEVQR + Deamidated (NQ) |
| 2977 |
657.3591 | 1312.7036 | 1312.6987 | 3.78 | 0 | 0 | 2.9 | 1Score > 18 indicates identity |
QGATPLVVVEGSR + Deamidated (NQ) |
| 3605 |
440.2393 | 1756.9281 | 1756.9505 | -12.8 | 1 | 0 | 3.6 | 1Score > 18 indicates identity |
STDNLPLREAIMLLR + Oxidation (M) |
| 2437 |
318.4972 | 952.4698 | 952.4726 | -2.98 | 0 | 0 | 2.3 | 1Score > 16 indicates identity |
NLVENAHR + Deamidated (NQ) |
| 4063 |
689.6917 | 2066.0533 | 2066.0717 | -8.93 | 1 | 0 | 3.4 | 1Score > 18 indicates identity |
RDAMQSLLLPPPAQQALAK + 3 Deamidated (NQ); Oxidation (M) |
| 3696 |
608.3314 | 1821.9724 | 1821.9658 | 3.59 | 1 | 0 | 2.7 | 1Score > 17 indicates identity |
MSGTVKLGYQRPLNIK + 2 Deamidated (NQ); Oxidation (M) |
| 2821 |
310.8900 | 1239.5309 | 1239.5367 | -4.72 | 0 | 0 | 0.97 | 1Score > 13 indicates identity |
FNSSLSEDGQR + Deamidated (NQ) |
| 2190 |
359.2047 | 716.3948 | 716.3817 | 18.4 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
GLTQAAR + Deamidated (NQ) |
| 2744 |
395.8796 | 1184.6170 | 1184.6149 | 1.74 | 1 | 0 | 3.3 | 1Score > 18 indicates identity |
DLPASERELR |
| 3072 |
682.8774 | 1363.7402 | 1363.7248 | 11.3 | 1 | 0 | 1.3 | 1Score > 14 indicates identity |
VFYPLNAKAADR |
| 3504 |
572.3337 | 1713.9793 | 1713.9600 | 11.3 | 1 | 0 | 0.97 | 1Score > 13 indicates identity |
ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M) |
| 3981 |
1005.5224 | 2009.0302 | 2008.9928 | 18.6 | 1 | 0 | 4.1 | 1Score > 19 indicates identity |
TISQLYDPEKGMFLPDR |
| 4072 |
692.6846 | 2075.0320 | 2075.0660 | -16.4 | 1 | 0 | 0.94 | 1Score > 20 indicates identity Score > 13 indicates homology |
LLEQAQEWPQPDGRPRR |
| 2820 |
619.2965 | 1236.5784 | 1236.5986 | -16.3 | 1 | 0 | 3.3 | 1Score > 18 indicates identity |
KTNVFNEQVR + 3 Deamidated (NQ) |
| 3009 |
443.8768 | 1328.6086 | 1328.6105 | -1.43 | 0 | 0 | 1.7 | 1Score > 15 indicates identity |
LFVMMTLGDDR + 2 Oxidation (M) |
| 3945 |
501.0288 | 2000.0861 | 2000.0612 | 12.4 | 1 | 0 | 1.8 | 1Score > 15 indicates identity |
KIVLALGGNALGDDLAGQMK + Deamidated (NQ); Oxidation (M) |
| 2426 |
315.4810 | 943.4212 | 943.4399 | -19.8 | 1 | 0 | 1.1 | 1Score > 13 indicates identity |
YEYAKNR + Deamidated (NQ) |
| 4042 |
1023.9916 | 2045.9686 | 2046.0051 | -17.8 | 0 | 0 | 3.7 | 1Score > 19 indicates identity |
ENVAALNINLSDADATLMR + Oxidation (M) |
| 2732 |
391.8580 | 1172.5522 | 1172.5747 | -19.2 | 0 | 0 | 2.1 | 1Score > 16 indicates identity |
NIAGMVDLNPK + 2 Deamidated (NQ) |
| 3171 |
349.9416 | 1395.7373 | 1395.7146 | 16.2 | 1 | 0 | 2.7 | 1Score > 17 indicates identity |
RYYSLTTHNLK + Deamidated (NQ) |
| 4329 |
654.3094 | 2613.2085 | 2613.2315 | -8.82 | 1 | 0 | 4 | 1Score > 19 indicates identity |
AISWSTDYQGMVNGILSGNGKQMR + Deamidated (NQ) |
| 2364 |
304.8355 | 911.4847 | 911.5018 | -18.7 | 1 | 0 | 1.6 | 1Score > 15 indicates identity |
FFFAPKR |
| 2774 |
401.8654 | 1202.5744 | 1202.5900 | -13.0 | 1 | 0 | 4 | 1Score > 19 indicates identity |
CQRCLLPEK |
| 3865 |
484.9809 | 1935.8945 | 1935.8646 | 15.5 | 1 | 0 | 3.4 | 1Score > 18 indicates identity |
QNSRTCYLSWHEAAGR + Deamidated (NQ) |
| 2877 |
633.3675 | 1264.7204 | 1264.7431 | -17.9 | 0 | 0 | 0.99 | 1Score > 13 indicates identity |
TFFTVIVPLTK |
| 3929 |
663.3433 | 1987.0081 | 1986.9799 | 14.2 | 0 | 0 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
HYPLEADNIFAAIAATNR + Deamidated (NQ) |
| 2788 |
610.3033 | 1218.5920 | 1218.5880 | 3.30 | 1 | 0 | 4.2 | 1Score > 19 indicates identity |
WEQIKTEER + Deamidated (NQ) |
| 4174 |
791.0797 | 2370.2173 | 2370.1864 | 13.0 | 0 | 0 | 3.5 | 1Score > 18 indicates identity |
DLNQELMRPHVFPFPLLMR + 2 Deamidated (NQ); Oxidation (M) |
| 3570 |
874.9022 | 1747.7898 | 1747.8199 | -17.2 | 0 | 0 | 2.9 | 1Score > 17 indicates identity |
IDVDEFSHCLSASLR |
| 2743 |
395.8716 | 1184.5930 | 1184.5720 | 17.7 | 0 | 0 | 3 | 1Score > 17 indicates identity |
MQHQVNVSAR + Oxidation (M) |
| 2965 |
653.3654 | 1304.7162 | 1304.6949 | 16.3 | 1 | 0 | 2.8 | 1Score > 17 indicates identity |
TNPVTGRVAPHR + Deamidated (NQ) |
| 4018 |
1019.5179 | 2037.0212 | 2037.0418 | -10.1 | 1 | 0 | 4.6 | 1Score > 19 indicates identity |
WVKQISEELHLDEILNA + Deamidated (NQ) |
| 2483 |
328.4836 | 982.4290 | 982.4212 | 7.94 | 0 | 0 | 1.5 | 1Score > 14 indicates identity |
VMSMNASAR + Deamidated (NQ); Oxidation (M) |
| 3270 |
484.9032 | 1451.6878 | 1451.7047 | -11.7 | 1 | 0 | 3.3 | 1Score > 18 indicates identity |
MLTRGMCVELAR + Oxidation (M) |
| 2910 |
640.3130 | 1278.6114 | 1278.5948 | 13.0 | 0 | 0 | 4.1 | 1Score > 19 indicates identity |
MMQLTGNPEVK + 2 Oxidation (M) |
| 2435 |
476.2516 | 950.4886 | 950.4756 | 13.7 | 1 | 0 | 3.8 | 1Score > 18 indicates identity |
KMDAHPPR |
| 4071 |
416.0015 | 2074.9711 | 2074.9849 | -6.65 | 1 | 0 | 3.7 | 1Score > 18 indicates identity |
MIKENQLMMLAHGVASPR + 2 Deamidated (NQ); 3 Oxidation (M) |
| 3977 |
503.2475 | 2008.9609 | 2008.9683 | -3.70 | 0 | 0 | 4.9 | 1Score > 20 indicates identity |
WDFLHFGLTGTSAFDPAK |
| 4356 |
888.4694 | 2662.3864 | 2662.3901 | -1.39 | 1 | 0 | 3.2 | 1Score > 18 indicates identity |
AHNSGHEVLIHLPMAPLSKQPLEK + Deamidated (NQ); Oxidation (M) |
| 3408 |
543.2846 | 1626.8320 | 1626.8512 | -11.8 | 1 | 0 | 4.1 | 1Score > 19 indicates identity |
MLQQIVTTAHQRGK + Deamidated (NQ); Oxidation (M) |
| 2854 |
628.3631 | 1254.7116 | 1254.7044 | 5.78 | 1 | 0 | 1.9 | 1Score > 15 indicates identity |
ERQAIEQLIR |
| 3352 |
769.4070 | 1536.7994 | 1536.7752 | 15.8 | 1 | 0 | 2.8 | 1Score > 17 indicates identity |
MISNAVNRLMISR + Deamidated (NQ); 2 Oxidation (M) |
| 2489 |
492.7168 | 983.4190 | 983.4165 | 2.63 | 0 | 0 | 1.1 | 1Score > 13 indicates identity |
TTCSLCSR |
| 4263 |
630.5433 | 2518.1441 | 2518.1805 | -14.5 | 0 | 0 | 3.1 | 1Score > 17 indicates identity |
FYTEDGNWDLVGNNTPIFFIR + Deamidated (NQ) |
| 3730 |
614.2960 | 1839.8662 | 1839.8315 | 18.8 | 0 | 0 | 3.3 | 1Score > 18 indicates identity |
YVWTTNGPEPLDYQR + 2 Deamidated (NQ) |
| 4524 |
993.7466 | 3970.9573 | 3970.9941 | -9.27 | 1 | 0 | 3.6 | 1Score > 18 indicates identity |
YTEALQQIGSSSNSKVVMMPLEASSLMGSIAGIAELVK + 2 Oxidation (M) |
| 2616 |
355.4718 | 1063.3936 | 1063.4054 | -11.1 | 0 | 0 | 1 | 1Score > 13 indicates identity |
ENNEDDATR + Deamidated (NQ) |
| 3019 |
668.8241 | 1335.6336 | 1335.6340 | -0.27 | 1 | 0 | 3.9 | 1Score > 18 indicates identity |
TEEEIVERGMK + Oxidation (M) |
| 1 |
300.0849 | 299.0776 | |||||||
| 2 |
300.1505 | 299.1432 | |||||||
| 3 |
300.1812 | 299.1739 | |||||||
| 4 |
300.1818 | 299.1745 | |||||||
| 5 |
301.0590 | 300.0517 | |||||||
| 6 |
301.0598 | 300.0525 | |||||||
| 7 |
301.0600 | 300.0527 | |||||||
| 8 |
301.0608 | 300.0535 | |||||||
| 9 |
301.0972 | 300.0899 | |||||||
| 10 |
301.1040 | 300.0967 | |||||||
| 11 |
301.1053 | 300.0980 | |||||||
| 12 |
301.1055 | 300.0982 | |||||||
| 13 |
301.1056 | 300.0983 | |||||||
| 14 |
301.1236 | 300.1163 | |||||||
| 15 |
301.1301 | 300.1228 | |||||||
| 16 |
301.1404 | 300.1331 | |||||||
| 17 |
301.1414 | 300.1341 | |||||||
| 18 |
301.1420 | 300.1347 | |||||||
| 19 |
301.1420 | 300.1347 | |||||||
| 20 |
301.1421 | 300.1348 | |||||||
| 21 |
301.1422 | 300.1349 | |||||||
| 22 |
301.1423 | 300.1350 | |||||||
| 23 |
301.1424 | 300.1351 | |||||||
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/