MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1249__2.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,429 residues)
Timestamp : 23 Jun 2025 at 17:08:04 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,602

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 4429)

Page: Previous 1 2 3 4 5 6 7 8 9 … 45 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3536 868.9828 1735.9510 1735.9468 2.43 1 2 1.3 +1Score > 16 indicates identity IVTEEVVVKNHNAVGK + Deamidated (NQ)
4527 1160.0759 4636.2745 4636.2386 7.73 1 2 1.9 +1Score > 17 indicates identity QTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQR + 5 Deamidated (NQ); 3 Oxidation (M)
3573 584.6444 1750.9114 1750.9002 6.36 0 2 2 +1Score > 18 indicates identity VNNFQVSAASTPFLTR
2550 508.7555 1015.4964 1015.5046 -8.04 1 2 1.9 +1Score > 17 indicates identity RANAQAAANK + 2 Deamidated (NQ)
3442 831.4324 1660.8502 1660.8283 13.2 1 2 3 +1Score > 19 indicates identity AMWPSTAKWLNDLK + Deamidated (NQ)
3223 476.5832 1426.7278 1426.7052 15.8 0 2 2.8 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
4240 828.4377 2482.2913 2482.3155 -9.75 1 2 2.2 +1Score > 18 indicates identity LQEMVADVSHHFPLRLPAPTPK
2789 610.3035 1218.5924 1218.5880 3.63 1 2 2.9 +1Score > 19 indicates identity WEQIKTEER + Deamidated (NQ)
4066 517.9933 2067.9441 2067.9639 -9.58 0 2 2.2 +1Score > 18 indicates identity SMVGISTDVMIVNCGSIPR + Deamidated (NQ); 2 Oxidation (M)
3000 662.3546 1322.6946 1322.7055 -8.17 1 2 1.9 +1Score > 17 indicates identity ALAALHDTARER
2885 635.8515 1269.6884 1269.7115 -18.1 0 2 2.3 +1Score > 18 indicates identity ISLPTPIMSGVR
4431 591.8934 2954.4306 2954.4495 -6.40 1 2 2.9 +1Score > 19 indicates identity TFATQKVSLEESVLSQVTTAIQNAQEK + 5 Deamidated (NQ)
3426 548.2925 1641.8557 1641.8695 -8.40 1 2 2.5 +1Score > 18 indicates identity VIGHSMQNCVLKLK + Oxidation (M)
4225 611.5715 2442.2569 2442.2556 0.51 1 2 2.2 +1Score > 18 indicates identity TIGYGESYINATGLRHVWHLR
2447 478.2620 954.5094 954.4995 10.4 0 2 1.6 +1Score > 17 indicates identity NRPQADVR
3092 683.8752 1365.7358 1365.7405 -3.38 1 2 1.3 +1Score > 16 indicates identity AYFTGAPTRAALK
2648 361.8666 1082.5780 1082.5832 -4.85 1 2 1.2 +1Score > 15 indicates identity EGNKPPKSAR
4012 407.2054 2030.9906 2030.9909 -0.14 1 2 3.1 +1Score > 19 indicates identity AVTDSDEPPVVRYDVQNK
2490 985.4755 984.4682 984.4665 1.78 0 2 1.4 +1Score > 16 indicates identity GTYPAYSAR
2513 496.7765 991.5384 991.5372 1.27 1 2 2 +1Score > 17 indicates identity LNKMGIATK + Deamidated (NQ); Oxidation (M)
3048 451.2233 1350.6481 1350.6602 -8.96 0 2 2.3 +1Score > 18 indicates identity NNVLSGLFCGLR + 2 Deamidated (NQ)
3203 356.1979 1420.7625 1420.7827 -14.2 1 2 1.6 +1Score > 16 indicates identity IKYPFLLSNGNR
2024 573.2634 572.2561 572.2554 1.24 0 2 0.67 +1Score > 13 indicates identity ADPNR + Deamidated (NQ)
3233 476.5842 1426.7308 1426.7052 17.9 0 2 3.2 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
3194 471.5835 1411.7287 1411.7203 5.91 1 2 1.9 +1Score > 17 indicates identity MIFMKNIGDALK + 2 Oxidation (M)
3780 625.3234 1872.9484 1872.9656 -9.18 0 2 3 +1Score > 19 indicates identity MTTNYIFVTGGVVSSLGK
2398 465.2639 928.5132 928.5090 4.57 1 2 2.6 +1Score > 18 indicates identity RLEQIDR
2849 627.3660 1252.7174 1252.7404 -18.3 1 2 0.82 +1Score > 13 indicates identity IVSVPLWQRR
3137 347.4261 1385.6753 1385.6609 10.4 0 2 3.3 +1Score > 19 indicates identity AEEPALNMLADGR
2508 494.7594 987.5042 987.4872 17.2 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 ELALEEER
2449 319.1773 954.5101 954.4995 11.1 0 2 1.9 +1Score > 17 indicates identity NRPQADVR
3540 435.2396 1736.9293 1736.9097 11.3 1 2 1.8 +1Score > 17 indicates identity AFKDIGFDSLAGVELR
3748 617.0163 1848.0271 1847.9928 18.6 1 2 1.2 +1Score > 15 indicates identity MELIFLGTSAGVPTRTR
2632 537.2549 1072.4952 1072.4938 1.39 1 2 1.2 +1Score > 15 indicates identity KDFNSYGSR
2942 647.3210 1292.6274 1292.6282 -0.60 0 1 3.1 +1Score > 19 indicates identity GMVIGASEGTEVK + Oxidation (M)
3998 1012.5323 2023.0500 2023.0561 -2.97 1 1 2.4 +1Score > 18 indicates identity MTIIAGLPVEYNDRFIR + Oxidation (M)
3080 341.9435 1363.7449 1363.7473 -1.76 1 1 0.93 +1Score > 14 indicates identity FRHGIAIAGTHGK
4342 658.3156 2629.2333 2629.2806 -18.0 1 1 3.1 +1Score > 19 indicates identity NIDSIPAETLRTLSNMEWPGNVR + Deamidated (NQ); Oxidation (M)
2694 567.3040 1132.5934 1132.5911 2.10 0 1 2.6 +1Score > 18 indicates identity DGAGVLVVMTR + Oxidation (M)
4256 837.0828 2508.2266 2508.2108 6.31 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VLGDAVFDDHNVFRAEFDIAMK
3254 721.8611 1441.7076 1441.7201 -8.65 0 1 1.7 +1Score > 16 indicates identity FHAQPLSANDTLK + Deamidated (NQ)
3228 476.5837 1426.7293 1426.7052 16.9 0 1 3.6 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
3876 487.9934 1947.9445 1947.9547 -5.22 0 1 3.3 +1Score > 19 indicates identity AVVLAGLPDVFCAGAAMDR + Oxidation (M)
4506 925.9566 3699.7973 3699.8469 -13.4 1 1 3.3 +1Score > 19 indicates identity LIRQEAGMVFQQFYLFPHLTALENVMFGPLR + 3 Deamidated (NQ); 2 Oxidation (M)
3325 752.3156 1502.6166 1502.6426 -17.3 0 1 0.74 +1Score > 13 indicates identity AWFAENPQGNDPR + 2 Deamidated (NQ)
4015 678.6717 2032.9933 2032.9921 0.56 1 1 3.5 +1Score > 19 indicates identity KVVIVGCGAQGLNQGLNMR + 4 Deamidated (NQ); Oxidation (M)
2801 613.8123 1225.6100 1225.5873 18.5 1 1 2.4 +1Score > 17 indicates identity ARTLGMYNSGR + Deamidated (NQ)
3949 667.7438 2000.2096 2000.1863 11.6 0 1 0.75 +1Score > 13 indicates identity NSFFIGLLPVLLVLWIR + Deamidated (NQ)
3470 564.3026 1689.8860 1689.8937 -4.60 1 1 3.2 +1Score > 19 indicates identity IFVASIRGDVQQQVK + 3 Deamidated (NQ)
2724 582.3261 1162.6376 1162.6346 2.64 1 1 1.8 +1Score > 16 indicates identity GLAYIKVNER + Deamidated (NQ)
4216 812.4262 2434.2568 2434.2816 -10.2 1 1 2.9 +1Score > 18 indicates identity QDILEAIRDHQVVIVAGETGSGK
2514 496.7766 991.5386 991.5372 1.47 1 1 2.3 +1Score > 17 indicates identity LNKMGIATK + Deamidated (NQ); Oxidation (M)
4250 834.7533 2501.2381 2501.2334 1.85 0 1 3.7 +1Score > 19 indicates identity LDIDFTFACEAEMLIFQLGLR
3897 653.6769 1958.0089 1957.9844 12.5 0 1 3.2 +1Score > 19 indicates identity ASVIDTATNAAPGTILEANK + 2 Deamidated (NQ)
2838 624.2994 1246.5842 1246.5612 18.5 0 1 2.6 +1Score > 18 indicates identity MNPETNSIANR + Deamidated (NQ)
2479 491.2016 980.3886 980.4055 -17.2 0 1 0.78 +1Score > 13 indicates identity MEMTNAQR + Deamidated (NQ)
2804 409.8770 1226.6092 1226.6077 1.17 0 1 2.7 +1Score > 18 indicates identity AQIIGGMEHVR + Deamidated (NQ); Oxidation (M)
3639 445.9864 1779.9165 1779.9229 -3.61 0 1 2.6 +1Score > 18 indicates identity LFELMQGFDAEVLLR
4155 768.4189 2302.2349 2302.2354 -0.25 1 1 2.1 +1Score > 17 indicates identity MPLSAQQLAAQKNLSYVLAEK
3062 454.5807 1360.7203 1360.7021 13.4 0 1 3.7 +1Score > 19 indicates identity DSGSDMVLVGLLR
2527 502.7593 1003.5040 1003.5087 -4.60 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VAAAQYEPR
3120 460.5625 1378.6657 1378.6881 -16.3 0 1 3.5 +1Score > 19 indicates identity FPYVNANVIDAR + Deamidated (NQ)
4320 650.3234 2597.2645 2597.2292 13.6 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 TQQLRQMNQHNGWLLEGQIER + 3 Deamidated (NQ); Oxidation (M)
4427 983.4780 2947.4122 2947.3546 19.5 0 1 0.81 +1Score > 20 indicates identity
Score > 13 indicates homology		 VVPDAGNLLAQQAIADVFCVNGDSEWR + 4 Deamidated (NQ)
2197 360.7057 719.3968 719.3966 0.31 0 1 2.4 +1Score > 17 indicates identity GEVLFR
2543 506.7380 1011.4614 1011.4734 -11.8 1 1 1.4 +1Score > 15 indicates identity DEPGPGRER
4089 419.2068 2090.9976 2090.9976 0.015 1 1 3.5 +1Score > 19 indicates identity AMNLSEDGVLVMQLEQRR + 3 Deamidated (NQ)
2967 654.3096 1306.6046 1306.6261 -16.4 0 1 2.1 +1Score > 17 indicates identity ELALLMSDAGCK
3771 468.0064 1867.9965 1868.0189 -12.0 0 1 2.2 +1Score > 17 indicates identity VRPGILAVEALNLMQSR + 2 Deamidated (NQ)
4257 628.3188 2509.2461 2509.2925 -18.5 1 1 3.6 +1Score > 19 indicates identity SQGSEFDHAALILPSQRTPVVTR + Deamidated (NQ)
3599 586.2822 1755.8248 1755.8540 -16.6 1 1 2.3 +1Score > 17 indicates identity AQGKYPVHLSGGQQQR + 3 Deamidated (NQ)
4285 639.5712 2554.2557 2554.2560 -0.11 1 1 3.6 +1Score > 19 indicates identity QISTIYQPMNQYKVVMEVDPR + Oxidation (M)
4056 687.6719 2059.9939 2059.9527 20.0 0 1 4 +1Score > 20 indicates identity GYYGWDFINDTQILTPR + 2 Deamidated (NQ)
2351 901.4757 900.4684 900.4665 2.18 1 1 2.7 +1Score > 18 indicates identity KEIPSGNR + Deamidated (NQ)
4047 410.4022 2046.9746 2046.9761 -0.73 1 1 3.4 +1Score > 19 indicates identity ENIMNNPVIGVVMCRNR + 2 Oxidation (M)
3588 877.4192 1752.8238 1752.8206 1.84 0 1 3.1 +1Score > 18 indicates identity LYDADLPEYNVAVDR + Deamidated (NQ)
4381 555.1091 2770.5091 2770.4640 16.3 1 1 1.1 +1Score > 14 indicates identity PIIQSVERALQILDLFNEQATELK + 3 Deamidated (NQ)
2536 1010.4874 1009.4801 1009.4651 14.9 0 1 1.7 +1Score > 16 indicates identity GMVFEQQR + Oxidation (M)
2557 510.7740 1019.5334 1019.5287 4.61 0 1 3.4 +1Score > 19 indicates identity LFEEQVVR + Deamidated (NQ)
2567 515.3030 1028.5914 1028.5978 -6.21 0 1 2.6 +1Score > 18 indicates identity LVLTTQAQR
3515 576.2780 1725.8122 1725.7846 16.0 0 1 2.1 +1Score > 17 indicates identity DEVFFNQTVENVQR + 2 Deamidated (NQ)
4061 516.7440 2062.9469 2062.9629 -7.76 1 1 3.5 +1Score > 19 indicates identity SNIINLEWQQIDMQRR + 4 Deamidated (NQ); Oxidation (M)
4044 512.5015 2045.9769 2045.9389 18.6 0 1 3.3 +1Score > 19 indicates identity LEAAVAQSEQQGEAALSDAR + 3 Deamidated (NQ)
2751 596.3229 1190.6312 1190.6520 -17.4 1 1 3.7 +1Score > 19 indicates identity DLLRDPGLHR
3221 476.5826 1426.7260 1426.7052 14.6 0 1 3.8 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
3752 617.6633 1849.9681 1849.9549 7.12 0 1 3.2 +1Score > 18 indicates identity AFTNYLPGFNIPMLPR
2224 743.4437 742.4364 742.4225 18.8 0 1 3.8 +1Score > 19 indicates identity DATPIVK
3621 442.7279 1766.8825 1766.8621 11.5 1 1 0.86 +1Score > 20 indicates identity
Score > 13 indicates homology		 MVQDAFSKVVSQADAR + Oxidation (M)
2858 629.2505 1256.4864 1256.4728 10.9 0 1 0.82 +1Score > 13 indicates identity GDYTCGGQDQR + Deamidated (NQ)
4364 675.8395 2699.3289 2699.3397 -4.01 0 1 3.4 +1Score > 19 indicates identity EDQPMMTQLLLLPLLQQLGQQSR + 4 Deamidated (NQ); Oxidation (M)
3776 624.0288 1869.0646 1869.0683 -2.00 1 1 0.83 +1Score > 13 indicates identity RIQILENTLATTLLNR + Deamidated (NQ)
3976 670.3496 2008.0270 2008.0063 10.3 0 1 3.3 +1Score > 19 indicates identity TWWGIVICFSMVISGPR
2231 374.7048 747.3950 747.3915 4.69 0 1 2.6 +1Score > 17 indicates identity LTPFDR
2450 478.2626 954.5106 954.4995 11.7 0 1 2.3 +1Score > 17 indicates identity NRPQADVR
3246 478.2309 1431.6709 1431.6956 -17.2 0 1 2.8 +1Score > 18 indicates identity VPETMPPQLFEK + Deamidated (NQ); Oxidation (M)
4341 526.8538 2629.2326 2629.2368 -1.60 1 1 3.6 +1Score > 19 indicates identity TTEQSWQQQTRTSQAAPVQAQPR + 3 Deamidated (NQ)
2863 419.8536 1256.5390 1256.5408 -1.47 0 1 1.1 +1Score > 14 indicates identity TTITEYNNDGK + 2 Deamidated (NQ)
3083 341.9437 1363.7457 1363.7473 -1.18 1 1 1.1 +1Score > 14 indicates identity FRHGIAIAGTHGK
3837 960.4236 1918.8326 1918.8400 -3.85 0 1 1.4 +1Score > 15 indicates identity NCQQAIAQGIAMVPEDR + 3 Deamidated (NQ); Oxidation (M)
2727 583.8338 1165.6530 1165.6455 6.48 0 1 1 +1Score > 13 indicates identity AQLSLQHIQK + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9 … 45 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/