MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1249__2.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,429 residues)
Timestamp : 23 Jun 2025 at 17:08:04 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,602

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4429)

Page: Previous 1 2 3 4 5 6 7 … 45 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2593 523.2686 1044.5226 1044.5200 2.58 1 8 0.61 +1Score > 19 indicates identity QDEQEIKR
2475 487.7425 973.4704 973.4539 17.0 0 8 0.65 +1Score > 19 indicates identity DPNEMLVR + Deamidated (NQ)
2808 615.8077 1229.6008 1229.5775 19.0 0 8 0.52 +1Score > 17 indicates identity VPQTEEELER + Deamidated (NQ)
2323 879.4594 878.4521 878.4531 -1.14 1 8 0.63 +1Score > 18 indicates identity MGSEISKK
2157 346.6730 691.3314 691.3323 -1.22 0 8 0.66 +1Score > 18 indicates identity MAGLER + Oxidation (M)
2167 350.2307 698.4468 698.4439 4.23 0 8 0.17 +1Score > 13 indicates identity IGLLAGR
1979 529.2750 528.2677 528.2656 4.03 0 8 0.17 +1Score > 13 indicates identity AGPQR + Deamidated (NQ)
3375 521.6011 1561.7815 1561.8100 -18.3 0 8 1 +1Score > 21 indicates identity
Score > 20 indicates homology		 GGFIESEGGGTVLLAR
2344 447.7361 893.4576 893.4607 -3.39 0 8 0.74 +1Score > 19 indicates identity FEATATVR
1983 529.2757 528.2684 528.2656 5.36 0 8 0.18 +1Score > 13 indicates identity AGPQR + Deamidated (NQ)
2766 601.8002 1201.5858 1201.5840 1.58 1 7 0.85 +1Score > 19 indicates identity QAERGIDWAR + Deamidated (NQ)
2083 324.1753 646.3360 646.3286 11.6 1 7 0.88 +1Score > 19 indicates identity KENEK
2393 310.5111 928.5115 928.5090 2.66 1 7 0.68 +1Score > 18 indicates identity GIQRGLER + Deamidated (NQ)
2645 540.7373 1079.4600 1079.4706 -9.74 0 7 0.25 +1Score > 14 indicates identity MNQQLSWR + 2 Deamidated (NQ); Oxidation (M)
4498 1191.2216 3570.6430 3570.6252 4.98 1 7 0.61 +1Score > 18 indicates identity MCELLGMSANVPTDICFSFTGLVQRGGGTGPHK + 2 Deamidated (NQ); 2 Oxidation (M)
2143 684.3625 683.3552 683.3602 -7.30 0 7 0.26 +1Score > 14 indicates identity IPSNPR + Deamidated (NQ)
2705 572.7731 1143.5316 1143.5421 -9.14 1 7 0.35 +1Score > 15 indicates identity HTTRNFPNR + 2 Deamidated (NQ)
3274 727.8754 1453.7362 1453.7460 -6.68 1 7 0.61 +1Score > 17 indicates identity DLSHGMQRIEIR
2850 627.3661 1252.7176 1252.7404 -18.2 1 7 0.25 +1Score > 13 indicates identity IVSVPLWQRR
4008 1016.0072 2029.9998 2030.0221 -11.0 1 7 1 +1Score > 19 indicates identity RDWQLQQLGITQWSLR + 3 Deamidated (NQ)
4222 610.8035 2439.1849 2439.2104 -10.5 0 7 1 +1Score > 20 indicates identity
Score > 19 indicates homology		 FVQPGTQVYDLGCSLGAATLSVR + Deamidated (NQ)
2544 338.1844 1011.5314 1011.5324 -1.00 0 7 0.38 +1Score > 15 indicates identity AAMAWLPPR
2924 643.3397 1284.6648 1284.6786 -10.7 1 7 0.83 +1Score > 18 indicates identity AIAELVNGDARR + Deamidated (NQ)
2144 342.6855 683.3564 683.3463 14.9 1 7 0.25 +1Score > 13 indicates identity HESRR
3020 669.3570 1336.6994 1336.7099 -7.80 1 7 0.89 +1Score > 19 indicates identity SPSAQKLEALHR + Deamidated (NQ)
3176 702.8515 1403.6884 1403.6867 1.24 0 7 0.96 +1Score > 19 indicates identity GISDLAQHYLMR + Deamidated (NQ)
3791 471.4737 1881.8657 1881.8639 0.97 1 7 0.89 +1Score > 19 indicates identity ADCEQLAELRSHAPER + Deamidated (NQ)
2454 479.2631 956.5116 956.5291 -18.2 0 6 1 +1Score > 19 indicates identity QDILEAIR
3575 438.7355 1750.9129 1750.9101 1.61 0 6 0.76 +1Score > 18 indicates identity LAEPAPTGEQLQNILR + 2 Deamidated (NQ)
2366 457.2010 912.3874 912.3937 -6.84 0 6 0.23 +1Score > 13 indicates identity DQLNHQR + 3 Deamidated (NQ)
3214 476.5806 1426.7200 1426.7052 10.4 0 6 1.1 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
4239 827.7393 2480.1961 2480.1828 5.36 1 6 0.94 +1Score > 19 indicates identity AMRLLVPPAWQNNPDMDPELR + 2 Deamidated (NQ); Oxidation (M)
4106 534.0483 2132.1641 2132.1266 17.6 1 6 0.41 +1Score > 15 indicates identity ESIQIFHNPRVLVEPEPK + Deamidated (NQ)
3140 347.9352 1387.7117 1387.6983 9.63 0 6 1.1 +1Score > 19 indicates identity QQNVPVFLLGDR + 3 Deamidated (NQ)
2104 332.6746 663.3346 663.3374 -4.11 0 6 1.2 +1Score > 20 indicates identity AALSMR + Oxidation (M)
2200 720.4066 719.3993 719.3966 3.78 0 6 0.69 +1Score > 17 indicates identity ALPTYR
3039 337.4402 1345.7317 1345.7282 2.62 0 6 0.67 +1Score > 17 indicates identity GEYLPIVELWK
3579 438.7370 1750.9189 1750.9254 -3.70 1 6 0.77 +1Score > 17 indicates identity AFKDLGFDSLAAVELR
2828 621.2905 1240.5664 1240.5870 -16.5 1 6 0.57 +1Score > 16 indicates identity NSYMGRLINR + 2 Deamidated (NQ); Oxidation (M)
2867 629.3173 1256.6200 1256.6010 15.1 0 6 0.81 +1Score > 18 indicates identity LAEHGATEHHR
2396 310.5116 928.5130 928.5090 4.27 1 6 0.91 +1Score > 18 indicates identity GIQRGLER + Deamidated (NQ)
3200 710.8478 1419.6810 1419.6590 15.6 1 6 1 +1Score > 19 indicates identity SVSRLGNSEQQGR + 3 Deamidated (NQ)
4069 518.7434 2070.9445 2070.9106 16.4 0 6 0.86 +1Score > 18 indicates identity CVVVVDHYDWEDDAPPR
2132 338.6754 675.3362 675.3261 15.0 0 6 1.1 +1Score > 19 indicates identity AMAELAA
3979 670.6836 2009.0290 2009.0079 10.5 1 6 1.2 +1Score > 19 indicates identity RWLESQGVDVANGSNHLK
2279 411.7290 821.4434 821.4508 -8.90 1 6 0.7 +1Score > 17 indicates identity QRLSYR
3116 345.4383 1377.7241 1377.7252 -0.79 0 6 0.94 +1Score > 18 indicates identity KPDHQLAALQEK + Deamidated (NQ)
3501 857.9945 1713.9744 1713.9625 6.98 1 6 0.3 +1Score > 13 indicates identity GVELLSTGGTARLLAEK
2282 822.4549 821.4476 821.4508 -3.82 1 6 0.45 +1Score > 15 indicates identity QRLSYR
2982 439.2336 1314.6790 1314.6932 -10.8 0 6 1.2 +1Score > 19 indicates identity AQNHLYTVLEK
2467 324.1748 969.5026 969.4920 10.9 1 6 0.64 +1Score > 16 indicates identity IRDYFQK + Deamidated (NQ)
3150 464.9209 1391.7409 1391.7482 -5.30 1 6 0.83 +1Score > 17 indicates identity QLALFKEMQGVK + Deamidated (NQ)
2401 930.5268 929.5195 929.5182 1.45 0 6 1 +1Score > 18 indicates identity IITQADLR + Deamidated (NQ)
2545 338.1864 1011.5374 1011.5284 8.92 1 6 0.43 +1Score > 14 indicates identity MLQKHAER
2619 532.7538 1063.4930 1063.4968 -3.51 1 6 0.75 +1Score > 17 indicates identity TAIDMDKNR + Deamidated (NQ)
3222 476.5827 1426.7263 1426.7092 12.0 0 5 1.3 +1Score > 19 indicates identity LGIPDEALHNYGK + Deamidated (NQ)
3896 980.0093 1958.0040 1958.0295 -13.0 1 5 1.2 +1Score > 19 indicates identity NLTILDMFGPPKTNAGIR + Deamidated (NQ)
2325 440.2341 878.4536 878.4610 -8.37 1 5 0.98 +1Score > 18 indicates identity PSTRYQK
3975 1005.0197 2008.0248 2008.0126 6.09 1 5 1.2 +1Score > 19 indicates identity HRIQVVFQDPNSSLNPR + 2 Deamidated (NQ)
4531 927.7491 5560.4509 5560.5454 -17.0 1 5 0.29 +1Score > 13 indicates identity APGSSSSGANGDGSLAQSQTGAVVRATNAASDFTLLELNTAANPAYNLFWAGWDR + 6 Deamidated (NQ)
2564 513.7325 1025.4504 1025.4600 -9.32 0 5 0.45 +1Score > 14 indicates identity ISQYACQR + Deamidated (NQ)
4415 978.4999 2932.4779 2932.4964 -6.31 1 5 1.1 +1Score > 18 indicates identity FNGKPASGLGVKLASGANEMATAELVLNR + 2 Deamidated (NQ); Oxidation (M)
3129 461.9169 1382.7289 1382.7228 4.42 1 5 1 +1Score > 18 indicates identity LAMQSVRSLFSK + Deamidated (NQ); Oxidation (M)
2797 613.2822 1224.5498 1224.5371 10.4 0 5 0.59 +1Score > 16 indicates identity TDQYGGSVENR
2771 401.8647 1202.5723 1202.5826 -8.55 1 5 1.2 +1Score > 18 indicates identity NAALNEMRQR + Deamidated (NQ)
3118 460.2490 1377.7252 1377.7041 15.3 0 5 1.1 +1Score > 18 indicates identity FPYVNANVIDAR
2853 628.3252 1254.6358 1254.6431 -5.75 1 5 0.94 +1Score > 17 indicates identity FMTFISPEKR
4221 488.8435 2439.1811 2439.2250 -18.0 1 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 SNIGHPQGAAGVAGVIKMVMALQR + 3 Deamidated (NQ); 2 Oxidation (M)
2295 418.2053 834.3960 834.4018 -6.85 1 5 0.83 +1Score > 17 indicates identity SAMDKGAR
2418 471.7764 941.5382 941.5406 -2.52 1 5 0.67 +1Score > 16 indicates identity IALAENRR
2733 393.5224 1177.5454 1177.5615 -13.7 0 5 1.1 +1Score > 18 indicates identity VLQEQEFER + Deamidated (NQ)
2515 331.8262 992.4568 992.4597 -2.94 0 5 0.7 +1Score > 16 indicates identity MATTVEADR
3034 671.8710 1341.7274 1341.7153 9.04 0 5 1.6 +1Score > 19 indicates identity LLADPHLGHVNR + Deamidated (NQ)
3877 488.2453 1948.9521 1948.9676 -7.97 0 5 0.96 +1Score > 20 indicates identity
Score > 17 indicates homology		 MLAQSLQALEQDGFLNR + Oxidation (M)
3248 478.5898 1432.7476 1432.7424 3.58 0 5 1.5 +1Score > 19 indicates identity IWFIPAMPETTK
2192 718.3281 717.3208 717.3293 -11.8 0 5 0.62 +1Score > 15 indicates identity VEGEER
3226 476.5834 1426.7284 1426.7092 13.4 0 5 1.6 +1Score > 19 indicates identity LGIPDEALHNYGK + Deamidated (NQ)
4196 803.7543 2408.2411 2408.2547 -5.65 1 5 1.4 +1Score > 19 indicates identity NLKLALTAGIGSDHVDLQSAIDR + 2 Deamidated (NQ)
3142 694.8682 1387.7218 1387.6943 19.9 1 5 1.5 +1Score > 19 indicates identity AIDSSPDKANLTR + Deamidated (NQ)
2525 502.2526 1002.4906 1002.4730 17.6 0 5 1.5 +1Score > 19 indicates identity NESAGEQLR
3478 565.9914 1694.9524 1694.9679 -9.14 0 5 0.51 +1Score > 14 indicates identity LLANRPESALAVTLAR + Deamidated (NQ)
3213 476.5804 1426.7194 1426.7092 7.12 0 5 1.6 +1Score > 19 indicates identity LGIPDEALHNYGK + Deamidated (NQ)
3809 633.6198 1897.8376 1897.8186 10.0 0 5 0.86 +1Score > 17 indicates identity SCAFLIADGVMPSNENR + 2 Deamidated (NQ); Oxidation (M)
4530 1112.8981 5559.4541 5559.5031 -8.80 1 5 0.34 +1Score > 13 indicates identity AFYSMGGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFNAETVKMFTTSSK + 5 Deamidated (NQ); 3 Oxidation (M)
3177 351.9294 1403.6885 1403.7005 -8.52 1 5 1.5 +1Score > 19 indicates identity RSETETVADALGR
2281 822.4536 821.4463 821.4508 -5.40 1 5 0.58 +1Score > 15 indicates identity QRLSYR
2786 610.3027 1218.5908 1218.6092 -15.0 0 5 1.5 +1Score > 19 indicates identity DTVSELLTANR + Deamidated (NQ)
4380 924.1334 2769.3784 2769.4218 -15.7 0 5 1.6 +1Score > 19 indicates identity IMDLQSAQQLGEIAAAVGLAQNLGALR + 3 Deamidated (NQ); Oxidation (M)
2887 636.3586 1270.7026 1270.6881 11.5 1 5 1.2 +1Score > 18 indicates identity DGKINLLDLNR + Deamidated (NQ)
3868 646.9586 1937.8540 1937.8789 -12.9 0 5 0.7 +1Score > 16 indicates identity LPSTCFAEENGSIVNSGR + Deamidated (NQ)
3216 476.5819 1426.7239 1426.7052 13.1 0 4 1.5 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
3414 818.4063 1634.7980 1634.7934 2.86 1 4 1.8 +1Score > 19 indicates identity SANMIDRDTLDALGK + Oxidation (M)
4211 607.0618 2424.2181 2424.2145 1.47 1 4 1.8 +1Score > 19 indicates identity SHGAANQRAFAVAIEQAVQAVQR + 3 Deamidated (NQ)
2712 577.2811 1152.5476 1152.5267 18.2 1 4 1.2 +1Score > 18 indicates identity MLQRMDSEK + Oxidation (M)
2684 561.8037 1121.5928 1121.5829 8.86 1 4 1.4 +1Score > 18 indicates identity GSAFTQEVKR
3580 584.6470 1750.9192 1750.9002 10.8 0 4 1.2 +1Score > 17 indicates identity VNNFQVSAASTPFLTR
3623 590.6443 1768.9111 1768.9206 -5.41 1 4 1.5 +1Score > 18 indicates identity ALDVATNVLQRNPNIK + 4 Deamidated (NQ)
2419 471.7767 941.5388 941.5406 -1.88 1 4 0.79 +1Score > 16 indicates identity IALAENRR
4340 658.3148 2629.2301 2629.2368 -2.56 1 4 1.6 +1Score > 19 indicates identity TTEQSWQQQTRTSQAAPVQAQPR + 3 Deamidated (NQ)
2870 420.8715 1259.5927 1259.5854 5.76 1 4 0.99 +1Score > 17 indicates identity GDASGDALNRQR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 … 45 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/