MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1249__1.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,429 residues)
Timestamp : 23 Jun 2025 at 17:07:31 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,592

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 501–600 (out of 4435)

Page: Previous 1 2 3 4 5 6 7 8 9 10 11 … 45 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4118 510.2425 2036.9409 2036.9619 -10.3 1 0 3.5 +1Score > 18 indicates identity IQRAGTMSGGEQQMLAIGR + 2 Deamidated (NQ); 2 Oxidation (M)
3660 534.9389 1601.7949 1601.7798 9.43 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 GIQDGDTVRLWNAR + 2 Deamidated (NQ)
4130 512.5012 2045.9757 2045.9389 18.0 0 0 4 +1Score > 19 indicates identity LEAAVAQSEQQGEAALSDAR + 3 Deamidated (NQ)
3987 487.7430 1946.9429 1946.9084 17.7 0 0 4.2 +1Score > 19 indicates identity LPNNSSPFYSTMGFLVR + 2 Deamidated (NQ); Oxidation (M)
4470 934.9506 3735.7733 3735.7780 -1.26 0 0 2.9 +1Score > 17 indicates identity QQLGLDQPLYHQFWHYISNAVQGDFGLSMVSR + 2 Deamidated (NQ)
1 300.1509 299.1436
2 300.1822 299.1749
3 300.1822 299.1749
4 301.0244 300.0171
5 301.0601 300.0528
6 301.0603 300.0530
7 301.0603 300.0530
8 301.0880 300.0807
9 301.1048 300.0975
10 301.1049 300.0976
11 301.1053 300.0980
12 301.1060 300.0987
13 301.1063 300.0990
14 301.1248 300.1175
15 301.1287 300.1214
16 301.1416 300.1343
17 301.1419 300.1346
18 301.1419 300.1346
19 301.1420 300.1347
20 301.1421 300.1348
21 301.1421 300.1348
22 301.1422 300.1349
23 301.1424 300.1351
24 301.1424 300.1351
25 301.1425 300.1352
26 301.1426 300.1353
27 301.1426 300.1353
28 301.1426 300.1353
29 301.1427 300.1354
30 301.1428 300.1355
31 301.1428 300.1355
32 301.1429 300.1356
33 301.1429 300.1356
34 301.1429 300.1356
35 301.1430 300.1357
36 301.1431 300.1358
37 301.1431 300.1358
38 301.1435 300.1362
39 301.1638 300.1565
40 302.1035 301.0962
41 302.1602 301.1529
42 302.1975 301.1902
43 302.1978 301.1905
44 302.1979 301.1906
45 303.0396 302.0323
46 303.0762 302.0689
47 303.0765 302.0692
48 303.0841 302.0768
49 303.0843 302.0770
50 303.0843 302.0770
51 303.0849 302.0776
52 303.0854 302.0781
53 303.0855 302.0782
54 303.1211 302.1138
55 303.1211 302.1138
56 303.1212 302.1139
57 303.1212 302.1139
58 303.1214 302.1141
59 303.1214 302.1141
60 303.1215 302.1142
61 303.1215 302.1142
62 303.1215 302.1142
63 303.1215 302.1142
64 303.1220 302.1147
65 303.1224 302.1151
66 303.1429 302.1356
67 303.1581 302.1508
68 303.1584 302.1511
69 303.1585 302.1512
70 303.1585 302.1512
71 303.1587 302.1514
72 303.1786 302.1713
73 303.1787 302.1714
74 304.1628 303.1555
75 304.1631 303.1558
76 305.0989 304.0916
77 305.0993 304.0920
78 305.0993 304.0920
79 305.0996 304.0923
80 305.0998 304.0925
81 305.1001 304.0928
82 305.1008 304.0935
83 305.1009 304.0936
84 305.1010 304.0937
85 305.1011 304.0938
86 305.1367 304.1294
87 305.1367 304.1294
88 305.1367 304.1294
89 305.1368 304.1295
90 305.1370 304.1297
91 305.1370 304.1297
92 305.1371 304.1298
93 305.1372 304.1299
94 305.1372 304.1299
95 305.1373 304.1300
Page: Previous 1 2 3 4 5 6 7 8 9 10 11 … 45 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/