MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1249__1.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,429 residues)
Timestamp : 23 Jun 2025 at 17:07:31 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,592

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4435)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 45 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3309 656.3325 1310.6504 1310.6506 -0.14 0 1 3 +1Score > 18 indicates identity QDVYYLEKPR + Deamidated (NQ)
3673 831.4332 1660.8518 1660.8283 14.2 1 1 3.9 +1Score > 19 indicates identity AMWPSTAKWLNDLK + Deamidated (NQ)
4195 767.7291 2300.1655 2300.1648 0.31 1 1 3.4 +1Score > 19 indicates identity EALRGHAAQLSQYNQVLASLK + 4 Deamidated (NQ)
4239 812.7917 2435.3533 2435.3094 18.0 1 1 0.96 +1Score > 13 indicates identity SLGVGFATRQVASMTKPTTIIEK + Deamidated (NQ)
4391 895.4613 2683.3621 2683.3470 5.61 0 1 3.2 +1Score > 19 indicates identity ALAQAMHQAGKPLGFMCIAPAMLPK + 2 Oxidation (M)
4415 931.4655 2791.3747 2791.4037 -10.4 1 1 3.5 +1Score > 19 indicates identity AAETLVQQGFVVLPYCGADPVLCKR + Deamidated (NQ)
2916 496.7762 991.5378 991.5372 0.67 1 1 2.5 +1Score > 17 indicates identity LNKMGIATK + Deamidated (NQ); Oxidation (M)
3147 401.5361 1201.5865 1201.5938 -6.12 1 1 3.8 +1Score > 19 indicates identity AEQAALQADKR + 2 Deamidated (NQ)
4359 654.3189 2613.2465 2613.2964 -19.1 1 1 4.1 +1Score > 20 indicates identity LPQTQARNMLIEAGGIMMPGNPIK + 2 Deamidated (NQ); 2 Oxidation (M)
3990 390.5962 1947.9446 1947.9547 -5.16 0 1 3.8 +1Score > 19 indicates identity AVVLAGLPDVFCAGAAMDR + Oxidation (M)
4478 1040.5190 4158.0469 4158.0790 -7.72 1 1 2.3 +1Score > 17 indicates identity MNTSHVRVVTHMCGFLVWLYSLSMLPPMVVALFYK + 2 Oxidation (M)
2872 485.7548 969.4950 969.4880 7.31 1 1 2.1 +1Score > 17 indicates identity VDDTGKAHK
4121 1019.5228 2037.0310 2037.0643 -16.3 1 1 3.6 +1Score > 19 indicates identity LTPEQWAQAGRLIAAGTPR + 2 Deamidated (NQ)
2606 352.1541 702.2936 702.3047 -15.7 0 1 0.83 +1Score > 13 indicates identity YDFMK
2960 508.7563 1015.4980 1015.5046 -6.46 1 1 2.6 +1Score > 17 indicates identity RANAQAAANK + 2 Deamidated (NQ)
3701 572.3328 1713.9766 1713.9600 9.69 1 1 0.95 +1Score > 13 indicates identity ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M)
4190 758.7366 2273.1880 2273.1573 13.5 1 1 2.1 +1Score > 17 indicates identity INKDDIVINDIAVSLSNICR + 2 Deamidated (NQ)
3180 310.8892 1239.5277 1239.5037 19.3 0 1 0.83 +1Score > 13 indicates identity DSMGQSLSGGER + Deamidated (NQ); Oxidation (M)
3211 628.3638 1254.7130 1254.7044 6.90 1 1 1.5 +1Score > 15 indicates identity ERQAIEQLIR
4325 859.7720 2576.2942 2576.3082 -5.43 1 1 3.7 +1Score > 19 indicates identity QGQQSAELRLHPQDLGEVQISLK + 3 Deamidated (NQ)
4371 656.3083 2621.2041 2621.2400 -13.7 1 1 2.9 +1Score > 18 indicates identity CPNGLPGVENRMQLLFSSGVMTGR + 2 Deamidated (NQ)
3713 576.2852 1725.8338 1725.8111 13.2 1 1 2.2 +1Score > 17 indicates identity GEFWSLDFLRNGER + Deamidated (NQ)
3750 583.9365 1748.7877 1748.8217 -19.5 1 1 2.3 +1Score > 17 indicates identity RNDDNTWTVTVADLK + 2 Deamidated (NQ)
4146 687.3499 2059.0279 2059.0156 5.94 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 WGIVNRVVSQAELMDNAR + 2 Deamidated (NQ)
2843 476.2513 950.4880 950.4756 13.1 1 1 2.8 +1Score > 18 indicates identity KMDAHPPR
3647 515.6066 1543.7980 1543.7995 -0.96 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 DDKTLSTNPLVWR
3980 647.6115 1939.8127 1939.8170 -2.23 0 1 0.84 +1Score > 13 indicates identity GISEQELNEYQQNVQR + 6 Deamidated (NQ)
3186 311.1481 1240.5633 1240.5684 -4.09 0 1 2.3 +1Score > 17 indicates identity EQASGAYSVSSR
4148 687.6950 2060.0632 2060.0386 11.9 1 1 3.4 +1Score > 19 indicates identity SQLQGLEKTDSGIQATLDR + Deamidated (NQ)
3194 415.1916 1242.5530 1242.5663 -10.7 0 1 1.2 +1Score > 14 indicates identity CTEEHQAIVR + Deamidated (NQ)
2832 473.2422 944.4698 944.4749 -5.40 0 1 3.2 +1Score > 18 indicates identity IPQQGMVR + Deamidated (NQ); Oxidation (M)
3663 817.9171 1633.8196 1633.8100 5.91 0 1 4 +1Score > 19 indicates identity QLIEAGFETGHAYAK
3811 597.6699 1789.9879 1790.0050 -9.58 1 1 0.98 +1Score > 13 indicates identity LTPLGRQLSQLPVDPR + Deamidated (NQ)
4051 664.3475 1990.0207 1990.0306 -4.97 1 1 3.5 +1Score > 19 indicates identity IASAIGRADGNPMYVISQK
4329 861.7630 2582.2672 2582.2976 -11.8 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 KALQLIPEGATGPGNSANWQGLGSSK + 2 Deamidated (NQ)
4136 513.7362 2050.9157 2050.9167 -0.48 1 1 2.1 +1Score > 16 indicates identity GDDIHWSMTGDNQKLYR + Oxidation (M)
4223 604.5744 2414.2685 2414.2378 12.7 1 1 3.2 +1Score > 18 indicates identity FVEGKPLMLEDSYMPVKLFR + Oxidation (M)
4217 803.7571 2408.2495 2408.2369 5.23 1 1 3.5 +1Score > 19 indicates identity LKANLINHNLTQEQVMEAALR + 3 Deamidated (NQ)
3458 347.9356 1387.7133 1387.7030 7.40 1 1 4 +1Score > 19 indicates identity MKALHFGAGNIGR + Deamidated (NQ); Oxidation (M)
4116 679.0212 2034.0418 2034.0792 -18.4 1 1 3.1 +1Score > 18 indicates identity RNQTLLTLHSLNMLHSR + Deamidated (NQ)
3173 615.8093 1229.6040 1229.6152 -9.10 1 1 2.6 +1Score > 17 indicates identity AELAEREWAR
3700 572.3326 1713.9760 1713.9600 9.34 1 1 1 +1Score > 13 indicates identity ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M)
4129 682.9991 2045.9755 2045.9946 -9.33 0 1 3.5 +1Score > 19 indicates identity FFNEAQELLASFNLSTSK + Deamidated (NQ)
2553 670.4272 669.4199 669.4173 3.86 0 0 0.89 +1Score > 13 indicates identity ATPLIR
4473 984.2628 3933.0221 3933.0242 -0.53 1 0 1.7 +1Score > 15 indicates identity MRFNPNLDPAWFGGVMAIINNITMLAIVLTGSALIR + 4 Deamidated (NQ)
4120 1019.5206 2037.0266 2037.0418 -7.45 1 0 4 +1Score > 19 indicates identity WVKQISEELHLDEILNA + Deamidated (NQ)
3751 583.9402 1748.7988 1748.8217 -13.1 1 0 2.8 +1Score > 17 indicates identity RNDDNTWTVTVADLK + 2 Deamidated (NQ)
2823 471.7758 941.5370 941.5447 -8.12 0 0 1.8 +1Score > 16 indicates identity HLITFGVR
2981 515.7509 1029.4872 1029.4702 16.6 0 0 1.4 +1Score > 14 indicates identity QMPGHFGQK + Deamidated (NQ)
4029 659.6844 1976.0314 1976.0327 -0.66 1 0 4.1 +1Score > 19 indicates identity IAEDGNPQVLIKNPPSQR + Deamidated (NQ)
2797 310.1584 927.4534 927.4450 9.00 0 0 1.6 +1Score > 15 indicates identity SGYFVAQR + Deamidated (NQ)
3612 742.8820 1483.7494 1483.7783 -19.5 0 0 3.3 +1Score > 18 indicates identity AVGGQITLHAFDAGK
3704 572.3339 1713.9799 1713.9600 11.6 1 0 0.91 +1Score > 13 indicates identity ILLIMGEWLAVQRR + Deamidated (NQ); Oxidation (M)
3632 378.1653 1508.6321 1508.6354 -2.19 0 0 0.91 +1Score > 13 indicates identity SNFDAMSGQYYAR
3232 634.3646 1266.7146 1266.6932 16.9 0 0 1.1 +1Score > 13 indicates identity TPVALLDAPASGR
3370 451.2200 1350.6382 1350.6602 -16.3 0 0 2.7 +1Score > 17 indicates identity NNVLSGLFCGLR + 2 Deamidated (NQ)
3925 626.9763 1877.9071 1877.9054 0.89 1 0 4.2 +1Score > 19 indicates identity ARAAGETVMVFPGQGSQR + Deamidated (NQ); Oxidation (M)
2774 457.2020 912.3894 912.3793 11.1 0 0 0.92 +1Score > 13 indicates identity MMTSQQR + 2 Oxidation (M)
2443 562.2599 561.2526 561.2507 3.48 0 0 0.92 +1Score > 13 indicates identity GSQNR + Deamidated (NQ)
2951 506.7379 1011.4612 1011.4734 -12.0 1 0 1.6 +1Score > 15 indicates identity DEPGPGRER
3442 460.5623 1378.6651 1378.6841 -13.8 1 0 4.1 +1Score > 19 indicates identity SQFAEAQRLTAR + 2 Deamidated (NQ)
3499 351.9298 1403.6901 1403.6681 15.7 0 0 3.9 +1Score > 19 indicates identity ELAYNAPGNQGLR + 2 Deamidated (NQ)
4036 659.6854 1976.0344 1976.0327 0.86 1 0 4.2 +1Score > 19 indicates identity IAEDGNPQVLIKNPPSQR + Deamidated (NQ)
3279 431.2284 1290.6634 1290.6853 -17.0 0 0 4.2 +1Score > 19 indicates identity ISTTLLNLMER + Deamidated (NQ)
4384 886.1346 2655.3820 2655.3942 -4.59 1 0 2.6 +1Score > 17 indicates identity IQSGELSAIPHQLIMDKIYDVLR + Deamidated (NQ); Oxidation (M)
3548 476.5841 1426.7305 1426.7052 17.7 0 0 4.4 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
3796 888.4624 1774.9102 1774.8751 19.8 1 0 3.9 +1Score > 19 indicates identity RQLPWTNAFADAQTR + Deamidated (NQ)
4426 979.4970 2935.4692 2935.4776 -2.87 0 0 4 +1Score > 19 indicates identity YSNLILNLFSLMVDANIPDIALEPDK + 2 Deamidated (NQ); Oxidation (M)
3336 662.7949 1323.5752 1323.5830 -5.87 0 0 1.4 +1Score > 14 indicates identity NANTVAFEDVDK + 2 Deamidated (NQ)
3725 435.2402 1736.9317 1736.9420 -5.96 1 0 2.4 +1Score > 17 indicates identity VNQPQDLGIALARAIR + 3 Deamidated (NQ)
4013 492.9839 1967.9065 1967.8901 8.31 0 0 3.1 +1Score > 18 indicates identity FSPFTAGNVVNHGFETDK + 2 Deamidated (NQ)
4362 654.5709 2614.2545 2614.2804 -9.92 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 LPQTQARNMLIEAGGIMMPGNPIK + 3 Deamidated (NQ); 2 Oxidation (M)
3859 914.9844 1827.9542 1827.9699 -8.56 1 0 3.5 +1Score > 18 indicates identity ILPPAIVNEMVMTGRR + 2 Oxidation (M)
4272 832.0825 2493.2257 2493.2203 2.17 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 MSEALLNAGRQTLMLELQEASR + Deamidated (NQ); 2 Oxidation (M)
3669 547.3051 1638.8935 1638.8651 17.3 1 0 1.8 +1Score > 15 indicates identity YGCLETVASLSALKK
3845 607.9971 1820.9695 1821.0004 -17.0 1 0 2.9 +1Score > 17 indicates identity HMELLAHSILKLICK + Oxidation (M)
3540 476.5827 1426.7263 1426.7092 12.0 0 0 4.5 +1Score > 19 indicates identity LGIPDEALHNYGK + Deamidated (NQ)
4012 491.9746 1963.8693 1963.9019 -16.6 0 0 2.1 +1Score > 16 indicates identity VALQGNMDPSMLYAPPAR + 2 Deamidated (NQ); 2 Oxidation (M)
4454 796.4006 3181.5733 3181.5536 6.19 1 0 3.7 +1Score > 18 indicates identity MSVSDAEPVMLEQISRISQQIGYYLHR + 2 Oxidation (M)
4189 1137.1113 2272.2080 2272.1984 4.24 1 0 2.3 +1Score > 16 indicates identity MSTQEATLQQPLLQAIDLKK + Deamidated (NQ); Oxidation (M)
4225 805.7641 2414.2705 2414.2378 13.5 1 0 3.6 +1Score > 18 indicates identity FVEGKPLMLEDSYMPVKLFR + Oxidation (M)
3982 485.9836 1939.9053 1939.9019 1.74 1 0 2.9 +1Score > 17 indicates identity LNDEIVMTPEMNFSKR + Deamidated (NQ); Oxidation (M)
4004 653.6812 1958.0218 1958.0255 -1.90 0 0 3.9 +1Score > 19 indicates identity LDRPTSGVLLMGLSSEAGR
3228 423.2117 1266.6133 1266.5914 17.2 0 0 3.4 +1Score > 18 indicates identity FVDMVDLANAR + Deamidated (NQ); Oxidation (M)
3010 350.1464 1047.4174 1047.4001 16.5 0 0 0.97 +1Score > 13 indicates identity MTMNSFER + Deamidated (NQ); 2 Oxidation (M)
3743 581.6664 1741.9774 1741.9661 6.45 1 0 1.5 +1Score > 14 indicates identity MIAHLQKLSFGQVVR + Oxidation (M)
2708 415.2207 828.4268 828.4395 -15.3 0 0 1.6 +1Score > 15 indicates identity AFIHWR
3307 655.8685 1309.7224 1309.6998 17.3 1 0 1.5 +1Score > 14 indicates identity MMLARHALALPA + Oxidation (M)
2926 332.4921 994.4545 994.4607 -6.30 0 0 2.7 +1Score > 17 indicates identity FEGTGVEEK
3959 640.9744 1919.9014 1919.9267 -13.2 0 0 4.1 +1Score > 19 indicates identity MISPQSIAVACAATGMVGR + Deamidated (NQ)
3973 968.9348 1935.8550 1935.8785 -12.1 0 0 2 +1Score > 16 indicates identity DEAHNVMSNLYYPEVR
4429 734.8810 2935.4949 2935.4895 1.83 0 0 3.7 +1Score > 18 indicates identity AVSGLNILTLMNNDMALIQLHHISQR + 2 Deamidated (NQ); 2 Oxidation (M)
3474 349.1996 1392.7693 1392.7653 2.90 1 0 1.6 +1Score > 15 indicates identity YFPNQKLVAALK + 2 Deamidated (NQ)
3224 630.3146 1258.6146 1258.6153 -0.51 1 0 3.7 +1Score > 18 indicates identity GDRANAVANLEK + 2 Deamidated (NQ)
3146 401.5355 1201.5847 1201.6051 -17.0 1 0 4.3 +1Score > 19 indicates identity NAQQIADRASK + Deamidated (NQ)
4149 516.4938 2061.9461 2061.9347 5.54 1 0 4.1 +1Score > 19 indicates identity MSSMTTTDNKAFLNELAR + Deamidated (NQ); 2 Oxidation (M)
4266 619.5906 2474.3333 2474.3070 10.6 1 0 2.4 +1Score > 16 indicates identity FFPAEANGGVKALQAIAGPFSQVR
4135 512.7521 2046.9793 2046.9694 4.85 1 0 4.2 +1Score > 19 indicates identity RCYEGVHALLDNGYQPR
4234 607.0628 2424.2221 2424.1858 15.0 0 0 4.3 +1Score > 19 indicates identity CLTAPGENALWFMYEPVLVSK
3326 441.8650 1322.5732 1322.5674 4.39 0 0 1.7 +1Score > 15 indicates identity NSSGGPSMGGPGFR + Oxidation (M)
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 45 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/