MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1249__1.mgf
Database : Ecoli-MetEng 20200720 (4,898 sequences; 1,660,429 residues)
Timestamp : 23 Jun 2025 at 17:07:31 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,592

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 17 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 4435)

Page: Previous 1 2 3 4 5 6 7 8 … 45 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2702 822.4537 821.4464 821.4508 -5.28 1 5 0.59 +1Score > 15 indicates identity QRLSYR
3496 468.9029 1403.6869 1403.6868 0.085 0 5 1.5 +1Score > 19 indicates identity IIPFSCVDGPGSR
2700 822.4532 821.4459 821.4508 -5.89 1 5 0.62 +1Score > 15 indicates identity QRLSYR
2427 543.3630 542.3557 542.3540 3.17 0 4 1.5 +1Score > 19 indicates identity AAIIR
3200 418.2061 1251.5965 1251.6207 -19.4 0 4 1.2 +1Score > 18 indicates identity ANQLAELAHQR + 2 Deamidated (NQ)
2994 519.7467 1037.4788 1037.4746 4.07 1 4 0.93 +1Score > 17 indicates identity RGDMLMQR + 2 Oxidation (M)
2590 346.6737 691.3328 691.3323 0.81 0 4 1.4 +1Score > 18 indicates identity GMLEAR + Oxidation (M)
2918 496.7773 991.5400 991.5372 2.89 1 4 0.99 +1Score > 17 indicates identity LNKMGIATK + Deamidated (NQ); Oxidation (M)
3822 901.4689 1800.9232 1800.9516 -15.7 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology		 VSAMPSTQQEVLRLSR
3043 537.2864 1072.5582 1072.5625 -3.96 1 4 0.94 +1Score > 20 indicates identity
Score > 17 indicates homology		 LSRSQPTER
2689 400.2077 798.4008 798.4137 -16.0 1 4 0.52 +1Score > 14 indicates identity FSRYAR
2593 693.3485 692.3412 692.3275 19.8 1 4 0.93 +1Score > 16 indicates identity MNREK + Oxidation (M)
2540 331.1763 660.3380 660.3377 0.47 0 4 1.2 +1Score > 17 indicates identity VQCVR
4413 924.1365 2769.3877 2769.4218 -12.3 0 4 1.8 +1Score > 19 indicates identity IMDLQSAQQLGEIAAAVGLAQNLGALR + 3 Deamidated (NQ); Oxidation (M)
3164 610.3055 1218.5964 1218.5880 6.91 1 4 1.8 +1Score > 19 indicates identity WEQIKTEER + Deamidated (NQ)
3522 474.9306 1421.7700 1421.7449 17.6 1 4 0.92 +1Score > 16 indicates identity VYAVKMNGQTVGR
3339 443.8980 1328.6722 1328.6738 -1.20 1 4 1.5 +1Score > 18 indicates identity YQKINAHHYR
3552 476.5843 1426.7311 1426.7052 18.1 0 4 1.9 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
4313 640.8355 2559.3129 2559.3189 -2.36 0 4 1.7 +1Score > 19 indicates identity AFNAEAGPLIAVCMGVITGVGGGIIR + Deamidated (NQ); Oxidation (M)
2955 338.1848 1011.5326 1011.5324 0.19 0 4 0.69 +1Score > 15 indicates identity AAMAWLPPR
3931 630.9647 1889.8723 1889.9022 -15.8 0 4 1.3 +1Score > 18 indicates identity YIEIWNIVFMQFNR + 2 Deamidated (NQ); Oxidation (M)
2741 440.2338 878.4530 878.4610 -9.05 1 4 1.4 +1Score > 18 indicates identity PSTRYQK
3538 476.5822 1426.7248 1426.7052 13.7 0 4 1.8 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
3488 349.9410 1395.7349 1395.7146 14.5 1 4 1.1 +1Score > 17 indicates identity RYYSLTTHNLK + Deamidated (NQ)
3534 476.5814 1426.7224 1426.7092 9.22 0 4 1.9 +1Score > 19 indicates identity LGIPDEALHNYGK + Deamidated (NQ)
3684 565.9932 1694.9578 1694.9679 -5.95 0 4 0.61 +1Score > 14 indicates identity LLANRPESALAVTLAR + Deamidated (NQ)
3770 878.4444 1754.8742 1754.8801 -3.31 0 4 1.5 +1Score > 18 indicates identity QSVFLYQLAVQTMPK + 3 Deamidated (NQ)
4042 990.9996 1979.9846 1979.9476 18.7 0 4 1.7 +1Score > 19 indicates identity ISDLNYSQHITLADNFK + 2 Deamidated (NQ)
3699 857.9944 1713.9742 1713.9625 6.87 1 4 0.49 +1Score > 13 indicates identity GVELLSTGGTARLLAEK
4265 618.8288 2471.2861 2471.2656 8.30 1 4 1.3 +1Score > 17 indicates identity VTLEIEQRYNHIPDTSSLSIR + Deamidated (NQ)
2428 543.3635 542.3562 542.3540 4.09 0 4 1.7 +1Score > 19 indicates identity AAIIR
3201 418.2130 1251.6172 1251.6208 -2.87 0 4 1.7 +1Score > 19 indicates identity GSGIHVVSNQPR + 2 Deamidated (NQ)
3542 476.5829 1426.7269 1426.7052 15.2 0 4 1.9 +1Score > 19 indicates identity LQQIEPNAGTEAR + Deamidated (NQ)
4151 689.3563 2065.0471 2065.0877 -19.7 1 4 1.6 +1Score > 18 indicates identity RDAMQSLLLPPPAQQALAK + 2 Deamidated (NQ); Oxidation (M)
2552 670.4264 669.4191 669.4173 2.66 0 4 0.42 +1Score > 13 indicates identity ATPLIR
3843 607.0009 1817.9809 1817.9781 1.50 1 4 1.1 +1Score > 17 indicates identity VLNLNQRTVSSIMTSR
3222 420.5425 1258.6057 1258.6014 3.39 1 4 1.5 +1Score > 18 indicates identity GDASGDALNRQR
3260 640.8044 1279.5942 1279.6045 -7.98 0 4 1.5 +1Score > 18 indicates identity ADEGYDVVGTVR
3210 419.2445 1254.7117 1254.7118 -0.096 1 4 0.82 +1Score > 15 indicates identity AGLAELGPMKIR
3367 337.4416 1345.7373 1345.7136 17.6 1 4 1.1 +1Score > 17 indicates identity MSELIVSRQQR
4002 653.6786 1958.0140 1958.0255 -5.89 0 4 1.8 +1Score > 19 indicates identity LDRPTSGVLLMGLSSEAGR
3945 954.4387 1906.8628 1906.8771 -7.48 0 4 1.5 +1Score > 18 indicates identity IAFLFTGQGSQYVNMGR + 3 Deamidated (NQ); Oxidation (M)
4204 786.4075 2356.2007 2356.1621 16.4 0 4 2.1 +1Score > 19 indicates identity GMPQIEVTFDIDADGILHVSAK + Deamidated (NQ)
4486 1160.0754 4636.2725 4636.2386 7.30 1 4 1.4 +1Score > 17 indicates identity QTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQR + 5 Deamidated (NQ); 3 Oxidation (M)
2844 477.2413 952.4680 952.4515 17.4 0 3 1.2 +1Score > 17 indicates identity TGWAPEHR
3585 728.3683 1454.7220 1454.7405 -12.7 0 3 1.7 +1Score > 18 indicates identity SFEPLENALAHVK + Deamidated (NQ)
4154 690.9860 2069.9362 2069.9694 -16.1 1 3 1.4 +1Score > 17 indicates identity LEFSIYRYNPDVDDAPR + Deamidated (NQ)
3280 431.2284 1290.6634 1290.6642 -0.64 0 3 2.1 +1Score > 19 indicates identity LLAMFDEVTPR
3716 864.4861 1726.9576 1726.9577 -0.041 1 3 1.1 +1Score > 16 indicates identity LNALEGKLQTGEISVR
4145 687.3444 2059.0114 2058.9900 10.4 1 3 0.68 +1Score > 20 indicates identity
Score > 14 indicates homology		 MIKENQLMMLAHGVASPR + 2 Deamidated (NQ); 2 Oxidation (M)
2520 322.1654 642.3162 642.3085 12.0 0 3 0.47 +1Score > 13 indicates identity HTTER
2856 319.1776 954.5110 954.5134 -2.57 0 3 1.3 +1Score > 17 indicates identity TPAAEITPR
4106 508.5065 2029.9969 2030.0028 -2.93 1 3 0.58 +1Score > 20 indicates identity
Score > 13 indicates homology		 AEPTSGGGQLSTAQKQNISR + Deamidated (NQ)
3118 585.7507 1169.4868 1169.4998 -11.1 0 3 0.79 +1Score > 15 indicates identity VMFGWMPDR + 2 Oxidation (M)
4128 682.3548 2044.0426 2044.0299 6.20 1 3 2.3 +1Score > 19 indicates identity IEFRVTTNPGQPMQPIAK + 2 Deamidated (NQ); Oxidation (M)
4461 856.4357 3421.7137 3421.6937 5.83 1 3 1.9 +1Score > 18 indicates identity MSQILLQPANAMITLENVNKWYGQFHVLK + 4 Deamidated (NQ); 2 Oxidation (M)
2768 454.2392 906.4638 906.4480 17.4 1 3 2.2 +1Score > 19 indicates identity EVQKEMK + Oxidation (M)
4158 519.7515 2074.9769 2075.0106 -16.2 1 3 1.9 +1Score > 18 indicates identity RVGETAWAQDTIADCLLR + Deamidated (NQ)
4109 678.0076 2031.0010 2030.9942 3.31 0 3 2.3 +1Score > 19 indicates identity LILGEAAETTLCGLDDNAR
2792 309.4755 925.4047 925.3964 8.98 0 3 0.71 +1Score > 14 indicates identity VGMNDFAR + Deamidated (NQ); Oxidation (M)
3724 868.9831 1735.9516 1735.9468 2.77 1 3 1 +1Score > 16 indicates identity IVTEEVVVKNHNAVGK + Deamidated (NQ)
3963 962.4359 1922.8572 1922.8462 5.76 1 3 1.1 +1Score > 16 indicates identity EQGMEGARDLALEMANR + Deamidated (NQ); 2 Oxidation (M)
4242 488.4532 2437.2296 2437.2570 -11.2 1 3 1.9 +1Score > 18 indicates identity SNIGHPQGAAGVAGVIKMVMALQR + Deamidated (NQ); 2 Oxidation (M)
4179 735.0566 2202.1480 2202.1579 -4.51 1 3 2.2 +1Score > 19 indicates identity LEPVPNADAPLGPGQVRVAMR + Oxidation (M)
3723 868.9823 1735.9500 1735.9468 1.85 1 3 1.1 +1Score > 16 indicates identity IVTEEVVVKNHNAVGK + Deamidated (NQ)
3237 636.3625 1270.7104 1270.6881 17.6 1 3 1.6 +1Score > 18 indicates identity DGKINLLDLNR + Deamidated (NQ)
3532 713.8943 1425.7740 1425.7616 8.73 0 3 1.3 +1Score > 17 indicates identity ALQEQIPDFIPR
4147 687.6724 2059.9954 2060.0109 -7.53 1 3 2.5 +1Score > 19 indicates identity SNIINLEWQQIDMQRR + Deamidated (NQ); Oxidation (M)
2854 478.2623 954.5100 954.4995 11.0 0 3 1.4 +1Score > 17 indicates identity NRPQADVR
3187 621.2908 1240.5670 1240.5605 5.25 0 3 1.2 +1Score > 16 indicates identity ISDNTVMTTSR + Deamidated (NQ); Oxidation (M)
3478 697.8734 1393.7322 1393.7565 -17.4 1 3 1.5 +1Score > 17 indicates identity GAVPDAVADPNLKK
2908 494.7587 987.5028 987.4872 15.8 0 3 2.5 +1Score > 19 indicates identity ELALEEER
2709 415.2318 828.4490 828.4527 -4.44 0 3 1.5 +1Score > 17 indicates identity LALMPQR + Deamidated (NQ)
3250 640.3128 1278.6110 1278.5948 12.7 0 3 2.2 +1Score > 19 indicates identity MMQLTGNPEVK + 2 Oxidation (M)
3192 622.2811 1242.5476 1242.5663 -15.0 0 3 0.63 +1Score > 13 indicates identity CTEEHQAIVR + Deamidated (NQ)
4077 670.6843 2009.0311 2008.9966 17.1 1 3 2.3 +1Score > 19 indicates identity HRIQVVFQDPNSSLNPR + 3 Deamidated (NQ)
3412 341.9444 1363.7485 1363.7473 0.88 1 3 0.68 +1Score > 14 indicates identity FRHGIAIAGTHGK
4469 926.2099 3700.8105 3700.7641 12.5 0 3 2 +1Score > 18 indicates identity IVIEEFLDGEEASFIVMVDGEHVLPMATSQDHK + Oxidation (M)
3485 349.9409 1395.7345 1395.7146 14.2 1 3 1.5 +1Score > 17 indicates identity RYYSLTTHNLK + Deamidated (NQ)
3030 532.7549 1063.4952 1063.5047 -8.84 0 3 1.6 +1Score > 17 indicates identity GQGAQLNGYR + Deamidated (NQ)
3444 345.9317 1379.6977 1379.6721 18.5 0 3 1.6 +1Score > 17 indicates identity FPYVNANVIDAR + 2 Deamidated (NQ)
4060 500.7539 1998.9865 1999.0011 -7.28 1 3 2.6 +1Score > 19 indicates identity TAKTPQWASQITGIPEDR + Deamidated (NQ)
3246 640.3094 1278.6042 1278.5948 7.39 0 3 1.9 +1Score > 18 indicates identity MMQLTGNPEVK + 2 Oxidation (M)
2710 415.2331 828.4516 828.4453 7.61 0 3 1.3 +1Score > 16 indicates identity AGIGINAGR + Deamidated (NQ)
2456 573.2647 572.2574 572.2554 3.51 0 3 0.54 +1Score > 13 indicates identity ADPNR + Deamidated (NQ)
4376 526.8545 2629.2361 2629.2368 -0.26 1 3 2.3 +1Score > 19 indicates identity TTEQSWQQQTRTSQAAPVQAQPR + 3 Deamidated (NQ)
4157 692.6642 2074.9708 2074.9861 -7.37 1 3 2 +1Score > 18 indicates identity NPTSPYSFVNYLHKHDR + Deamidated (NQ)
3281 323.6735 1290.6649 1290.6788 -10.8 0 3 2.5 +1Score > 19 indicates identity TGLMMLVGSINR
3884 616.3342 1845.9808 1845.9737 3.83 1 3 2.4 +1Score > 19 indicates identity ALGWKPQETFESGIRK
4282 839.4453 2515.3141 2515.3138 0.097 1 3 1.9 +1Score > 18 indicates identity RMISGEMDVVLVPQGTLIEQIR + 2 Oxidation (M)
4298 638.8202 2551.2517 2551.2377 5.50 1 3 2.2 +1Score > 19 indicates identity MHEKLSTDTQPLNYFNALSAVR + Deamidated (NQ); Oxidation (M)
3964 962.4365 1922.8584 1922.8462 6.38 1 3 1.3 +1Score > 16 indicates identity EQGMEGARDLALEMANR + Deamidated (NQ); 2 Oxidation (M)
3726 435.2403 1736.9321 1736.8992 19.0 1 3 1.4 +1Score > 17 indicates identity MVALNLRQHISDPAR + Deamidated (NQ); Oxidation (M)
3951 638.2956 1911.8650 1911.8850 -10.5 1 3 2.1 +1Score > 18 indicates identity SKDNNLEAFYLATPDGR + 2 Deamidated (NQ)
2914 496.7745 991.5344 991.5161 18.6 0 3 1.6 +1Score > 17 indicates identity IPAYEMIR
3510 353.1926 1408.7413 1408.7133 19.9 1 3 1.7 +1Score > 17 indicates identity QTRYGMDGKPIK + Oxidation (M)
4173 708.6932 2123.0578 2123.0681 -4.84 0 3 2.4 +1Score > 19 indicates identity IGEHTPSALAIMENANVLAR + Deamidated (NQ); Oxidation (M)
4016 659.3505 1975.0297 1975.0208 4.49 1 2 2.2 +1Score > 18 indicates identity RGGGNERPQNNRPAAKPR + Deamidated (NQ)
4152 518.2451 2068.9513 2068.9854 -16.5 1 2 2 +1Score > 18 indicates identity LEFSIYRYNPDVDDAPR
3938 634.9634 1901.8684 1901.8867 -9.65 1 2 2.3 +1Score > 19 indicates identity NRYLLHLNQEASDGDR + 2 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 … 45 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/