MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 4 |
| MS data file | : | PRT1231_JBEI_4.mgf |
| Database | : | A-oryzae 20191108 (12,205 sequences; 5,465,702 residues) |
| Timestamp | : | 1 May 2025 at 20:40:53 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,452 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 22 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 4287 |
897.9153 | 1793.8160 | 1793.8505 | -19.2 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
MNDLTSDLPYEDILR |
| 3934 |
584.7990 | 1167.5834 | 1167.5706 | 11.0 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
RSGYMVNTPK + Oxidation (M) |
| 3914 |
572.2892 | 1142.5638 | 1142.5502 | 11.9 | 1 | 4 | 0.94 | 1Score > 22 indicates identity Score > 16 indicates homology |
QRAGTPEMPR + Deamidated (NQ) |
| 4375 |
749.0685 | 2244.1837 | 2244.2188 | -15.6 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
KLILEADVVLDGYRPGVMEK |
| 3550 |
387.7417 | 773.4688 | 773.4647 | 5.37 | 1 | 4 | 0.45 | 1Score > 20 indicates identity Score > 13 indicates homology |
KVDIATK |
| 4371 |
742.7155 | 2225.1247 | 2225.1427 | -8.08 | 0 | 4 | 0.45 | 1Score > 23 indicates identity Score > 13 indicates homology |
LNELQASDVSLRPDPEIISK + 2 Deamidated (NQ) |
| 4117 |
695.8842 | 1389.7538 | 1389.7728 | -13.7 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
GNASVYGNVIKLR |
| 4391 |
773.7120 | 2318.1142 | 2318.1430 | -12.4 | 1 | 4 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
AQLPELSYYQAVGKSAETPHK + 2 Deamidated (NQ) |
| 4201 |
784.9163 | 1567.8180 | 1567.8392 | -13.5 | 1 | 4 | 0.44 | 1Score > 23 indicates identity Score > 13 indicates homology |
SRLQTAPVPMPDLK + Oxidation (M) |
| 3989 |
414.9210 | 1241.7412 | 1241.7166 | 19.8 | 0 | 4 | 1.1 | 1Score > 16 indicates identity |
IPAMGATSLIIR |
| 4013 |
633.8184 | 1265.6222 | 1265.6074 | 11.7 | 1 | 4 | 0.75 | 1Score > 24 indicates identity Score > 15 indicates homology |
KVFGAMDDLDR |
| 3415 |
321.7385 | 641.4624 | 641.4588 | 5.69 | 1 | 4 | 0.62 | 1Score > 14 indicates identity |
KLLLR |
| 4286 |
597.6679 | 1789.9819 | 1789.9951 | -7.40 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
WQLAPPTTPRPLTRR + Deamidated (NQ) |
| 4350 |
696.3696 | 2086.0870 | 2086.0517 | 16.9 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
MLSQIDEPYPKDIERPR |
| 4319 |
635.0038 | 1901.9896 | 1902.0139 | -12.8 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
SGVKVVTIYAFSIENFK + Deamidated (NQ) |
| 4288 |
599.3322 | 1794.9748 | 1794.9529 | 12.2 | 1 | 4 | 2.1 | 1Score > 19 indicates identity |
WGNLAEVNAVRFAHLV |
| 4381 |
752.4169 | 2254.2289 | 2254.1966 | 14.3 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
QVDVLIVGAGPAGLMAALWMAR + Oxidation (M) |
| 3740 |
319.1786 | 954.5140 | 954.5148 | -0.82 | 1 | 4 | 0.57 | 1Score > 21 indicates identity Score > 14 indicates homology |
NLYRHPR |
| 3962 |
602.2956 | 1202.5766 | 1202.5567 | 16.5 | 0 | 4 | 0.88 | 1Score > 24 indicates identity Score > 16 indicates homology |
DGNVNIWDLR + 2 Deamidated (NQ) |
| 3780 |
502.2673 | 1002.5200 | 1002.5345 | -14.5 | 1 | 4 | 1 | 1Score > 25 indicates identity Score > 16 indicates homology |
AEKVAQETK |
| 3922 |
577.2993 | 1152.5840 | 1152.5788 | 4.53 | 0 | 4 | 0.82 | 1Score > 22 indicates identity Score > 15 indicates homology |
FRPQSEHPR |
| 3788 |
338.1814 | 1011.5224 | 1011.5025 | 19.6 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
AFEDYVLR |
| 4341 |
670.6865 | 2009.0377 | 2009.0694 | -15.8 | 1 | 4 | 0.51 | 1Score > 23 indicates identity Score > 13 indicates homology |
DIISNISNTPPVRFHTAK |
| 3525 |
372.7183 | 743.4220 | 743.4330 | -14.7 | 0 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
ALQWVK |
| 4254 |
556.9469 | 1667.8189 | 1667.8114 | 4.45 | 1 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
SGAVPQRDLDELPNR + 2 Deamidated (NQ) |
| 4101 |
457.9234 | 1370.7484 | 1370.7704 | -16.0 | 1 | 3 | 0.69 | 1Score > 22 indicates identity Score > 14 indicates homology |
GIKSAAMVLAASPR |
| 3835 |
527.7520 | 1053.4894 | 1053.4801 | 8.90 | 0 | 3 | 0.85 | 1Score > 21 indicates identity Score > 15 indicates homology |
AEVAFMNEK + Oxidation (M) |
| 3711 |
310.5143 | 928.5211 | 928.5164 | 5.01 | 0 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
QVVPLSMR |
| 3631 |
428.7688 | 855.5230 | 855.5290 | -6.97 | 1 | 3 | 0.91 | 1Score > 20 indicates identity Score > 15 indicates homology |
IAEIVRR |
| 4360 |
1063.0547 | 2124.0948 | 2124.0959 | -0.48 | 1 | 3 | 0.55 | 1Score > 23 indicates identity Score > 13 indicates homology |
SVQRIMDVLAAMIQEFLK + Deamidated (NQ); 2 Oxidation (M) |
| 4285 |
596.6326 | 1786.8760 | 1786.8957 | -11.0 | 0 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
IASYVINSMSSAMILR + 2 Oxidation (M) |
| 3613 |
418.7325 | 835.4504 | 835.4439 | 7.79 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
VAELYNK |
| 3980 |
615.3502 | 1228.6858 | 1228.6775 | 6.78 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
ALIDLNSTNLR |
| 3905 |
566.3151 | 1130.6156 | 1130.5931 | 19.9 | 1 | 3 | 0.97 | 1Score > 24 indicates identity Score > 16 indicates homology |
KDSDNKPSIK |
| 3634 |
430.2158 | 858.4170 | 858.4195 | -2.87 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
NAAAVQQR + 2 Deamidated (NQ) |
| 4025 |
429.2299 | 1284.6679 | 1284.6534 | 11.2 | 1 | 3 | 0.78 | 1Score > 23 indicates identity Score > 15 indicates homology |
QIAQQDAERAR |
| 4112 |
463.5784 | 1387.7134 | 1387.6884 | 18.0 | 1 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
LHPDFKDVNFR + Deamidated (NQ) |
| 4251 |
554.9335 | 1661.7787 | 1661.7719 | 4.08 | 0 | 3 | 0.78 | 1Score > 23 indicates identity Score > 15 indicates homology |
NMEGAHLVTIEEFR + Deamidated (NQ); Oxidation (M) |
| 4361 |
716.7101 | 2147.1085 | 2147.1045 | 1.87 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
IVCNNDQQASIFLQQKLK + Deamidated (NQ) |
| 3439 |
329.6889 | 657.3632 | 657.3558 | 11.3 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
SPNGRK |
| 3599 |
411.7292 | 821.4438 | 821.4548 | -13.3 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
RGLWYK |
| 4448 |
1130.5560 | 3388.6462 | 3388.6166 | 8.72 | 0 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
ALSLADNSTALLVEYSEEVPVMLSNFGMSNR + 2 Oxidation (M) |
| 4332 |
654.0128 | 1959.0166 | 1958.9949 | 11.1 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
IVLDTDDPAFGGLNRNLK + 2 Deamidated (NQ) |
| 3642 |
435.7764 | 869.5382 | 869.5334 | 5.54 | 0 | 3 | 1.6 | 1Score > 18 indicates identity |
VQLELLR |
| 3850 |
537.2859 | 1072.5572 | 1072.5625 | -4.90 | 1 | 3 | 0.63 | 1Score > 25 indicates identity Score > 14 indicates homology |
LGNRSDNAVK |
| 3860 |
542.8431 | 1083.6716 | 1083.6651 | 6.00 | 1 | 3 | 0.79 | 1Score > 15 indicates identity |
LAELIEKLR |
| 3593 |
409.7231 | 817.4316 | 817.4480 | -20.0 | 1 | 3 | 1 | 1Score > 25 indicates identity Score > 16 indicates homology |
LGNRVMK + Deamidated (NQ) |
| 3925 |
579.3209 | 1156.6272 | 1156.6451 | -15.5 | 0 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
ALANALESIVR + Deamidated (NQ) |
| 3517 |
368.2070 | 734.3994 | 734.4075 | -11.0 | 1 | 3 | 0.59 | 1Score > 22 indicates identity Score > 13 indicates homology |
KLFGDR |
| 4121 |
470.9056 | 1409.6950 | 1409.6986 | -2.58 | 1 | 3 | 0.67 | 1Score > 24 indicates identity Score > 14 indicates homology |
IMQPSHARWER |
| 3556 |
393.2370 | 784.4594 | 784.4443 | 19.3 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
KPAGLGDK |
| 4314 |
943.9979 | 1885.9812 | 1885.9720 | 4.91 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
IYGNAIQMLYGKISSGR + Oxidation (M) |
| 4041 |
653.7731 | 1305.5316 | 1305.5507 | -14.6 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
GSTLDDPMPNSR + Deamidated (NQ); Oxidation (M) |
| 4087 |
341.9443 | 1363.7481 | 1363.7401 | 5.88 | 1 | 3 | 0.7 | 1Score > 20 indicates identity Score > 14 indicates homology |
QFLFRFEHIK |
| 4228 |
803.9052 | 1605.7958 | 1605.8263 | -19.0 | 1 | 3 | 0.79 | 1Score > 24 indicates identity Score > 14 indicates homology |
VSAREIDAYWLQR |
| 3779 |
502.2348 | 1002.4550 | 1002.4553 | -0.21 | 0 | 3 | 0.76 | 1Score > 21 indicates identity Score > 14 indicates homology |
MHNLSTQR + Deamidated (NQ); Oxidation (M) |
| 3977 |
611.8420 | 1221.6694 | 1221.6903 | -17.1 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
QAFMRSLILK + Oxidation (M) |
| 3759 |
489.2776 | 976.5406 | 976.5229 | 18.2 | 0 | 3 | 0.71 | 1Score > 22 indicates identity Score > 14 indicates homology |
FEINAALAK + Deamidated (NQ) |
| 4416 |
854.7804 | 2561.3194 | 2561.3208 | -0.56 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
SAKIIAMMVVGFCVLAAFVAYER + Oxidation (M) |
| 3636 |
432.2300 | 862.4454 | 862.4548 | -10.9 | 0 | 3 | 0.56 | 1Score > 23 indicates identity Score > 13 indicates homology |
QKPQSFK + Deamidated (NQ) |
| 3764 |
494.2617 | 986.5088 | 986.5145 | -5.73 | 0 | 3 | 0.72 | 1Score > 24 indicates identity Score > 14 indicates homology |
AQQSADIVR |
| 4049 |
658.8536 | 1315.6926 | 1315.6884 | 3.19 | 1 | 3 | 0.64 | 1Score > 24 indicates identity Score > 13 indicates homology |
KQYHTNTPTVK |
| 4392 |
775.7183 | 2324.1331 | 2324.1358 | -1.18 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
MGFLNIWSTGKVQNLANATQK + 4 Deamidated (NQ) |
| 4182 |
758.4263 | 1514.8380 | 1514.8416 | -2.36 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
QLTLSDATLRIER |
| 3790 |
338.1855 | 1011.5347 | 1011.5210 | 13.5 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
SLHARGESR |
| 3483 |
350.2437 | 698.4728 | 698.4691 | 5.43 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
LQVIVK |
| 3937 |
586.3287 | 1170.6428 | 1170.6244 | 15.7 | 0 | 3 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
QLVEDIEGLR |
| 3520 |
369.1965 | 736.3784 | 736.3755 | 3.96 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
SLIYNQ |
| 3861 |
543.3170 | 1084.6194 | 1084.5989 | 19.0 | 1 | 3 | 0.99 | 1Score > 22 indicates identity Score > 15 indicates homology |
LVRAVANGER + Deamidated (NQ) |
| 4304 |
464.0099 | 1852.0105 | 1851.9843 | 14.2 | 1 | 3 | 0.66 | 1Score > 20 indicates identity Score > 13 indicates homology |
GLNVPSILRIENSWPR + 2 Deamidated (NQ) |
| 3428 |
325.1888 | 648.3630 | 648.3595 | 5.45 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
IVFDR |
| 3656 |
442.7441 | 883.4736 | 883.4763 | -3.01 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
QLEAVAPR + Deamidated (NQ) |
| 3910 |
567.8022 | 1133.5898 | 1133.5717 | 16.0 | 0 | 2 | 1 | 1Score > 24 indicates identity Score > 15 indicates homology |
IIFGDEVADR |
| 3384 |
308.7122 | 615.4098 | 615.4068 | 5.00 | 1 | 2 | 0.93 | 1Score > 20 indicates identity Score > 15 indicates homology |
KLLSR |
| 4064 |
669.8525 | 1337.6904 | 1337.6714 | 14.2 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
SIVATIQGEKYE + Deamidated (NQ) |
| 3647 |
437.7145 | 873.4144 | 873.4093 | 5.89 | 0 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
HGLDNYR |
| 4386 |
571.5407 | 2282.1337 | 2282.1464 | -5.56 | 1 | 2 | 1 | 1Score > 24 indicates identity Score > 15 indicates homology |
GSITTQDFLNEATKIMDIIR + Deamidated (NQ); Oxidation (M) |
| 3988 |
621.8776 | 1241.7406 | 1241.7166 | 19.4 | 1 | 2 | 1.5 | 1Score > 16 indicates identity |
MPVVIARSLQK + Deamidated (NQ) |
| 4247 |
827.9246 | 1653.8346 | 1653.8079 | 16.2 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
NAMNLIYSNRTMAR |
| 4048 |
658.8349 | 1315.6552 | 1315.6619 | -5.09 | 0 | 2 | 0.95 | 1Score > 24 indicates identity Score > 15 indicates homology |
LQSTAQDVISPR + 2 Deamidated (NQ) |
| 3371 |
301.6865 | 601.3584 | 601.3548 | 6.15 | 0 | 2 | 1 | 1Score > 27 indicates identity Score > 15 indicates homology |
LTVNR |
| 3826 |
523.2935 | 1044.5724 | 1044.5644 | 7.70 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
LFKFSFQK + Deamidated (NQ) |
| 3919 |
576.2859 | 1150.5572 | 1150.5466 | 9.29 | 1 | 2 | 1 | 1Score > 24 indicates identity Score > 15 indicates homology |
SQQSNTSLKR + 3 Deamidated (NQ) |
| 3822 |
523.2825 | 1044.5504 | 1044.5451 | 5.13 | 1 | 2 | 0.88 | 1Score > 24 indicates identity Score > 14 indicates homology |
EREQQLLK + 2 Deamidated (NQ) |
| 3356 |
566.2635 | 565.2562 | 565.2530 | 5.72 | 0 | 2 | 2.8 | 1Score > 19 indicates identity |
NTMGK + Oxidation (M) |
| 3947 |
396.9018 | 1187.6836 | 1187.6914 | -6.57 | 0 | 2 | 2.9 | 1Score > 19 indicates identity |
LIPQLLNSYK |
| 4394 |
791.4102 | 2371.2088 | 2371.2246 | -6.66 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
LNKYVNPSLIMPLDGAWLPGR + 2 Deamidated (NQ); Oxidation (M) |
| 3831 |
525.3425 | 1048.6704 | 1048.6505 | 19.0 | 1 | 2 | 0.62 | 1Score > 13 indicates identity |
VSKPPLPRR |
| 4045 |
656.4065 | 1310.7984 | 1310.7921 | 4.81 | 1 | 2 | 0.74 | 1Score > 13 indicates identity |
GLLLEILGRQAK + Deamidated (NQ) |
| 4397 |
597.5751 | 2386.2713 | 2386.2910 | -8.24 | 1 | 2 | 0.99 | 1Score > 21 indicates identity Score > 15 indicates homology |
HWRLIGWANIVAGNTLEPILN |
| 3958 |
401.2205 | 1200.6397 | 1200.6363 | 2.79 | 1 | 2 | 1 | 1Score > 24 indicates identity Score > 15 indicates homology |
KAPQRPEYGR |
| 4249 |
831.3970 | 1660.7794 | 1660.7879 | -5.08 | 0 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
NMEGAHLVTIEEFR + Oxidation (M) |
| 3408 |
317.1946 | 632.3746 | 632.3857 | -17.5 | 1 | 2 | 1.7 | 1Score > 17 indicates identity |
SSLKAK |
| 3746 |
322.1762 | 963.5068 | 963.4960 | 11.2 | 0 | 2 | 1 | 1Score > 23 indicates identity Score > 14 indicates homology |
QPPICPPR |
| 4028 |
429.2445 | 1284.7117 | 1284.6939 | 13.9 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
QHSIGGFKVQGK |
| 4132 |
714.3716 | 1426.7286 | 1426.7416 | -9.05 | 1 | 2 | 0.9 | 1Score > 23 indicates identity Score > 14 indicates homology |
GPSLKEIQEAEAR |
| 3651 |
438.7313 | 875.4480 | 875.4535 | -6.20 | 0 | 2 | 1 | 1Score > 25 indicates identity Score > 14 indicates homology |
MLTSPTAR |
| 3567 |
395.2366 | 788.4586 | 788.4545 | 5.32 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
IFREPK |
| 3903 |
564.8328 | 1127.6510 | 1127.6299 | 18.8 | 0 | 2 | 0.78 | 1Score > 21 indicates identity Score > 13 indicates homology |
STLLNNLPTR |
| 4419 |
648.5792 | 2590.2877 | 2590.3247 | -14.3 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 14 indicates homology |
GQVLMIPALVTEDCYASQVARLR + Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/