MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 4
MS data file : PRT1231_JBEI_4.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:40:53 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,452

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 22 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 46)


Page: 1 2 3 4 5 Next 

-1

Accession Score Description
1 IGF1_BOVIN 698 Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal
Score Mass Matches Sequences emPAI
1.1 IGF1_BOVIN 698 42206 58 (37) 24 (19) 7.91
Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal

-58 peptide matches (40 non-duplicate, 18 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
3364   579.3168 578.3095 578.3064 5.38 0 23 0.043 +1Score > 25 indicates identity
Score > 22 indicates homology
U K.GIDFK.E
3430 +1 325.6514 649.2882 649.2854 4.46 0 27 0.01 +1Score > 20 indicates identity U R.SCDLR.R
3434 +1 328.1961 654.3776 654.3741 5.42 0 35 0.00046 +1Score > 14 indicates identity U R.TIFFK.D
3435   655.3853 654.3780 654.3741 6.00 0 30 0.0016 +1Score > 14 indicates identity U R.TIFFK.D
3568   395.6833 789.3520 789.3479 5.20 0 6 1 +1Score > 21 indicates identity
Score > 18 indicates homology
U R.YPDHMK.Q
3598 +1 411.2030 820.3914 820.3868 5.67 0 31 0.0065 +1Score > 22 indicates identity
Score > 22 indicates homology
U K.QHDFFK.S
3602   826.4171 825.4098 825.4055 5.25 0 20 0.064 +1Score > 21 indicates identity U K.FICTTGK.L
3603 +1 413.7122 825.4098 825.4055 5.28 0 33 0.0032 +1Score > 21 indicates identity U K.FICTTGK.L
3698   307.5128 919.5166 919.5127 4.22 1 19 0.021 +1Score > 21 indicates identity
Score > 14 indicates homology
U K.NGIKVNFK.I + Deamidated (NQ)
3699   460.7665 919.5184 919.5127 6.26 1 19 0.077 +1Score > 21 indicates identity
Score > 21 indicates homology
U K.NGIKVNFK.I + Deamidated (NQ)
3761   328.1715 981.4927 981.4879 4.82 0 8 1 +1Score > 21 indicates identity
Score > 20 indicates homology
U K.EDGNILGHK.L
3762   491.7542 981.4938 981.4879 6.01 0 43 0.00042 +1Score > 22 indicates identity U K.EDGNILGHK.L
3832 +1 525.7664 1049.5182 1049.5142 3.88 0 56 3.3e-005 +1Score > 23 indicates identity U K.FEGDTLVNR.I
4011 +1 633.7960 1265.5774 1265.5710 5.08 0 40 0.00092 +1Score > 23 indicates identity
Score > 22 indicates homology
U K.SAMPEGYVQER.T
4021 +1 641.7938 1281.5730 1281.5659 5.55 0 79 6.9e-008 +1Score > 22 indicates identity
Score > 20 indicates homology
U K.SAMPEGYVQER.T + Oxidation (M)
4069 +1 674.3362 1346.6578 1346.6507 5.33 1 58 5.1e-006 +1Score > 24 indicates identity
Score > 18 indicates homology
U R.TIFFKDDGNYK.T
4071 +1 449.8933 1346.6581 1346.6507 5.50 1 35 0.00097 +1Score > 24 indicates identity
Score > 18 indicates homology
U R.TIFFKDDGNYK.T
4124   710.8737 1419.7328 1419.7254 5.25 0 38 0.0017 +1Score > 23 indicates identity U R.LEMYCAPLKPAK.S
4139   479.5836 1435.7290 1435.7203 6.04 0 33 0.0055 +1Score > 23 indicates identity U R.LEMYCAPLKPAK.S + Oxidation (M)
4158   739.3900 1476.7654 1476.7572 5.55 1 32 0.0013 +1Score > 24 indicates identity
Score > 16 indicates homology
U R.AEVKFEGDTLVNR.I
4159   493.2628 1476.7666 1476.7572 6.31 1 59 3.8e-006 +1Score > 23 indicates identity
Score > 17 indicates homology
U R.AEVKFEGDTLVNR.I
4160   493.5971 1477.7695 1477.7413 19.1 1 33 0.0034 +1Score > 23 indicates identity
Score > 20 indicates homology
U R.AEVKFEGDTLVNR.I + Deamidated (NQ)
4172 +2 752.3367 1502.6588 1502.6525 4.21 0 89 4.8e-009 +1Score > 21 indicates identity
Score > 18 indicates homology
U K.FSVSGEGEGDATYGK.L
4185   511.9506 1532.8300 1532.8198 6.61 1 8 0.18 +1Score > 21 indicates identity
Score > 14 indicates homology
U K.FEGDTLVNRIELK.G
4192 +1 386.4555 1541.7929 1541.7838 5.90 1 20 0.1 +1Score > 24 indicates identity
Score > 22 indicates homology
U K.GIDFKEDGNILGHK.L
4193 +2 514.9383 1541.7931 1541.7838 6.02 1 53 5.8e-005 +1Score > 24 indicates identity U K.GIDFKEDGNILGHK.L
4197   776.8514 1551.6882 1551.6810 4.66 0 73 3.5e-007 +1Score > 21 indicates identity U R.APQTGIVDECCFR.S
4206 -2 526.2858 1575.8356 1575.8265 5.76 1 30 0.0019 +1Score > 23 indicates identity
Score > 15 indicates homology
U R.RLEMYCAPLKPAK.S
4208   526.2868 1575.8386 1575.8265 7.67 1 (26) 0.025 +1Score > 22 indicates identity U R.RLEMYCAPLKPAK.S
4209   526.2878 1575.8416 1575.8265 9.57 1 (0) 1 +1Score > 22 indicates identity
Score > 13 indicates homology
U R.RLEMYCAPLKPAK.S
4207 +1 394.9662 1575.8357 1575.8265 5.84 1 28 0.0055 +1Score > 23 indicates identity
Score > 17 indicates homology
U R.RLEMYCAPLKPAK.S
4213   531.6173 1591.8301 1591.8214 5.44 1 21 0.011 +1Score > 23 indicates identity
Score > 14 indicates homology
U R.RLEMYCAPLKPAK.S + Oxidation (M)
4214 +1 398.9649 1591.8305 1591.8214 5.71 1 28 0.019 +1Score > 23 indicates identity U R.RLEMYCAPLKPAK.S + Oxidation (M)
4253   556.9368 1667.7886 1667.7580 18.3 0 20 0.019 +1Score > 23 indicates identity
Score > 15 indicates homology
U R.GFYFNKPTGYGSSSR.R + Deamidated (NQ)
4260   570.2706 1707.7900 1707.7821 4.60 1 27 0.022 +1Score > 23 indicates identity U R.RAPQTGIVDECCFR.S
4262   570.6057 1708.7953 1708.7661 17.1 1 19 0.079 +1Score > 24 indicates identity
Score > 20 indicates homology
U R.RAPQTGIVDECCFR.S + Deamidated (NQ)
4334   658.9783 1973.9131 1973.8829 15.3 0 42 0.00015 +1Score > 23 indicates identity
Score > 16 indicates homology
U K.LEYNYNSHNVYIMADK.Q + Deamidated (NQ)
4339   664.3098 1989.9076 1989.8778 15.0 0 31 0.0085 +1Score > 23 indicates identity U K.LEYNYNSHNVYIMADK.Q + Deamidated (NQ); Oxidation (M)
4372   558.5244 2230.0685 2230.0364 14.4 1 8 0.19 +1Score > 23 indicates identity
Score > 13 indicates homology
U K.LEYNYNSHNVYIMADKQK.N + Deamidated (NQ)
4379   562.5229 2246.0625 2246.0313 13.9 1 6 0.76 +1Score > 24 indicates identity
Score > 17 indicates homology
U K.LEYNYNSHNVYIMADKQK.N + Deamidated (NQ); Oxidation (M)
4407   813.4285 2437.2637 2437.2377 10.7 0 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology
U K.GEELFTGVVPILVELDGDVNGHK.F + Deamidated (NQ)
4451   895.6457 4473.1921 4473.1360 12.5 0 11 0.66 +1Score > 22 indicates identity U R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D + 2 Deamidated (NQ)

4 subsets and intersections (5 subset proteins in total)

Score Mass Subset of
B7UCZ6_9RHAB 562 85329 1.1
G protein/GFP fusion protein OS=Recombinant vesicular stomatitis Indiana virus rVSV-G/GFP OX=582817 GN=G PE=3 SV=1
1 sameset of B7UCZ6_9RHAB
GFP_AEQVI 562 26983
Green fluorescent protein OS=Aequorea victoria GN=GFP PE=1 SV=1
Q2U8R9_ASPOR 38 0 1.1
description
Q2UG34_ASPOR 27 0 1.1
description
Q2UMK6_ASPOR 23 0 1.1
description

+2

Accession Score Description
1 FHP_YEAST 480 Flavohemoprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHB1 PE=1 SV=2

+3

Accession Score Description
1 TRYP_PIG 195 Trypsin OS=Sus scrofa PE=1 SV=1

+4

Accession Score Description
1 Q2UU95_ASPOR 191 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000405 PE=3 SV=1

+5

Accession Score Description
1 Q2UHF6_ASPOR 156 Aldedh domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000467 PE=3 SV=1

+6

Accession Score Description
1 Q2U480_ASPOR 143 eIF-5a domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000450 PE=4 SV=1

+7

Accession Score Description
1 Q2U2R5_ASPOR 140 WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000349 PE=4 SV=1

+8

Accession Score Description
1 Q2ULW0_ASPOR 100 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000247 PE=4 SV=1

+9

Accession Score Description
1 Q2UK92_ASPOR 71 AlcB domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000906 PE=4 SV=1

+10

Accession Score Description
1 EF1A_ASPOR 51 Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=tef1 PE=3 SV=1
Page: 1 2 3 4 5 Next 

Not what you expected? Try the select summary.