MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 4 |
| MS data file | : | PRT1231_JBEI_4.mgf |
| Database | : | A-oryzae 20191108 (12,205 sequences; 5,465,702 residues) |
| Timestamp | : | 1 May 2025 at 20:40:53 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,452 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 22 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
1| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | IGF1_BOVIN | 698 | Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal |
| Score | Mass | Matches | Sequences | emPAI | |||
|---|---|---|---|---|---|---|---|
| 1.1 | IGF1_BOVIN |
698 | 42206 | 58 (37) | 24 (19) | 7.91 | |
| Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal | |||||||
58 peptide matches (40 non-duplicate, 18 duplicate)| Query | Dupes | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | U | Peptide |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Query | Dupes | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | U | Peptide |
| 3364 |
579.3168 | 578.3095 | 578.3064 | 5.38 | 0 | 23 | 0.043 | 1Score > 25 indicates identity Score > 22 indicates homology |
U | K.GIDFK.E | |
| 3430 |
1 |
325.6514 | 649.2882 | 649.2854 | 4.46 | 0 | 27 | 0.01 | 1Score > 20 indicates identity |
U | R.SCDLR.R |
| 3434 |
1 |
328.1961 | 654.3776 | 654.3741 | 5.42 | 0 | 35 | 0.00046 | 1Score > 14 indicates identity |
U | R.TIFFK.D |
| 3435 |
655.3853 | 654.3780 | 654.3741 | 6.00 | 0 | 30 | 0.0016 | 1Score > 14 indicates identity |
U | R.TIFFK.D | |
| 3568 |
395.6833 | 789.3520 | 789.3479 | 5.20 | 0 | 6 | 1 | 1Score > 21 indicates identity Score > 18 indicates homology |
U | R.YPDHMK.Q | |
| 3598 |
1 |
411.2030 | 820.3914 | 820.3868 | 5.67 | 0 | 31 | 0.0065 | 1Score > 22 indicates identity Score > 22 indicates homology |
U | K.QHDFFK.S |
| 3602 |
826.4171 | 825.4098 | 825.4055 | 5.25 | 0 | 20 | 0.064 | 1Score > 21 indicates identity |
U | K.FICTTGK.L | |
| 3603 |
1 |
413.7122 | 825.4098 | 825.4055 | 5.28 | 0 | 33 | 0.0032 | 1Score > 21 indicates identity |
U | K.FICTTGK.L |
| 3601 |
413.7121 | 825.4096 | 825.4055 | 5.04 | 0 | (8) | 0.22 | 1Score > 21 indicates identity Score > 14 indicates homology |
U | K.FICTTGK.L | |
| 3698 |
307.5128 | 919.5166 | 919.5127 | 4.22 | 1 | 19 | 0.021 | 1Score > 21 indicates identity Score > 14 indicates homology |
U | K.NGIKVNFK.I + Deamidated (NQ) | |
| 3699 |
460.7665 | 919.5184 | 919.5127 | 6.26 | 1 | 19 | 0.077 | 1Score > 21 indicates identity Score > 21 indicates homology |
U | K.NGIKVNFK.I + Deamidated (NQ) | |
| 3761 |
328.1715 | 981.4927 | 981.4879 | 4.82 | 0 | 8 | 1 | 1Score > 21 indicates identity Score > 20 indicates homology |
U | K.EDGNILGHK.L | |
| 3762 |
491.7542 | 981.4938 | 981.4879 | 6.01 | 0 | 43 | 0.00042 | 1Score > 22 indicates identity |
U | K.EDGNILGHK.L | |
| 3832 |
1 |
525.7664 | 1049.5182 | 1049.5142 | 3.88 | 0 | 56 | 3.3e-005 | 1Score > 23 indicates identity |
U | K.FEGDTLVNR.I |
| 4011 |
1 |
633.7960 | 1265.5774 | 1265.5710 | 5.08 | 0 | 40 | 0.00092 | 1Score > 23 indicates identity Score > 22 indicates homology |
U | K.SAMPEGYVQER.T |
| 4021 |
1 |
641.7938 | 1281.5730 | 1281.5659 | 5.55 | 0 | 79 | 6.9e-008 | 1Score > 22 indicates identity Score > 20 indicates homology |
U | K.SAMPEGYVQER.T + Oxidation (M) |
| 4069 |
1 |
674.3362 | 1346.6578 | 1346.6507 | 5.33 | 1 | 58 | 5.1e-006 | 1Score > 24 indicates identity Score > 18 indicates homology |
U | R.TIFFKDDGNYK.T |
| 4071 |
1 |
449.8933 | 1346.6581 | 1346.6507 | 5.50 | 1 | 35 | 0.00097 | 1Score > 24 indicates identity Score > 18 indicates homology |
U | R.TIFFKDDGNYK.T |
| 4124 |
710.8737 | 1419.7328 | 1419.7254 | 5.25 | 0 | 38 | 0.0017 | 1Score > 23 indicates identity |
U | R.LEMYCAPLKPAK.S | |
| 4139 |
479.5836 | 1435.7290 | 1435.7203 | 6.04 | 0 | 33 | 0.0055 | 1Score > 23 indicates identity |
U | R.LEMYCAPLKPAK.S + Oxidation (M) | |
| 4158 |
739.3900 | 1476.7654 | 1476.7572 | 5.55 | 1 | 32 | 0.0013 | 1Score > 24 indicates identity Score > 16 indicates homology |
U | R.AEVKFEGDTLVNR.I | |
| 4159 |
493.2628 | 1476.7666 | 1476.7572 | 6.31 | 1 | 59 | 3.8e-006 | 1Score > 23 indicates identity Score > 17 indicates homology |
U | R.AEVKFEGDTLVNR.I | |
| 4160 |
493.5971 | 1477.7695 | 1477.7413 | 19.1 | 1 | 33 | 0.0034 | 1Score > 23 indicates identity Score > 20 indicates homology |
U | R.AEVKFEGDTLVNR.I + Deamidated (NQ) | |
| 4172 |
2 |
752.3367 | 1502.6588 | 1502.6525 | 4.21 | 0 | 89 | 4.8e-009 | 1Score > 21 indicates identity Score > 18 indicates homology |
U | K.FSVSGEGEGDATYGK.L |
| 4185 |
511.9506 | 1532.8300 | 1532.8198 | 6.61 | 1 | 8 | 0.18 | 1Score > 21 indicates identity Score > 14 indicates homology |
U | K.FEGDTLVNRIELK.G | |
| 4192 |
1 |
386.4555 | 1541.7929 | 1541.7838 | 5.90 | 1 | 20 | 0.1 | 1Score > 24 indicates identity Score > 22 indicates homology |
U | K.GIDFKEDGNILGHK.L |
| 4193 |
2 |
514.9383 | 1541.7931 | 1541.7838 | 6.02 | 1 | 53 | 5.8e-005 | 1Score > 24 indicates identity |
U | K.GIDFKEDGNILGHK.L |
| 4197 |
776.8514 | 1551.6882 | 1551.6810 | 4.66 | 0 | 73 | 3.5e-007 | 1Score > 21 indicates identity |
U | R.APQTGIVDECCFR.S | |
| 4206 |
2 |
526.2858 | 1575.8356 | 1575.8265 | 5.76 | 1 | 30 | 0.0019 | 1Score > 23 indicates identity Score > 15 indicates homology |
U | R.RLEMYCAPLKPAK.S |
| 4207 |
1 |
394.9662 | 1575.8357 | 1575.8265 | 5.84 | 1 | 28 | 0.0055 | 1Score > 23 indicates identity Score > 17 indicates homology |
U | R.RLEMYCAPLKPAK.S |
| 4213 |
531.6173 | 1591.8301 | 1591.8214 | 5.44 | 1 | 21 | 0.011 | 1Score > 23 indicates identity Score > 14 indicates homology |
U | R.RLEMYCAPLKPAK.S + Oxidation (M) | |
| 4214 |
1 |
398.9649 | 1591.8305 | 1591.8214 | 5.71 | 1 | 28 | 0.019 | 1Score > 23 indicates identity |
U | R.RLEMYCAPLKPAK.S + Oxidation (M) |
| 4253 |
556.9368 | 1667.7886 | 1667.7580 | 18.3 | 0 | 20 | 0.019 | 1Score > 23 indicates identity Score > 15 indicates homology |
U | R.GFYFNKPTGYGSSSR.R + Deamidated (NQ) | |
| 4260 |
570.2706 | 1707.7900 | 1707.7821 | 4.60 | 1 | 27 | 0.022 | 1Score > 23 indicates identity |
U | R.RAPQTGIVDECCFR.S | |
| 4262 |
570.6057 | 1708.7953 | 1708.7661 | 17.1 | 1 | 19 | 0.079 | 1Score > 24 indicates identity Score > 20 indicates homology |
U | R.RAPQTGIVDECCFR.S + Deamidated (NQ) | |
| 4334 |
658.9783 | 1973.9131 | 1973.8829 | 15.3 | 0 | 42 | 0.00015 | 1Score > 23 indicates identity Score > 16 indicates homology |
U | K.LEYNYNSHNVYIMADK.Q + Deamidated (NQ) | |
| 4339 |
664.3098 | 1989.9076 | 1989.8778 | 15.0 | 0 | 31 | 0.0085 | 1Score > 23 indicates identity |
U | K.LEYNYNSHNVYIMADK.Q + Deamidated (NQ); Oxidation (M) | |
| 4372 |
558.5244 | 2230.0685 | 2230.0364 | 14.4 | 1 | 8 | 0.19 | 1Score > 23 indicates identity Score > 13 indicates homology |
U | K.LEYNYNSHNVYIMADKQK.N + Deamidated (NQ) | |
| 4379 |
562.5229 | 2246.0625 | 2246.0313 | 13.9 | 1 | 6 | 0.76 | 1Score > 24 indicates identity Score > 17 indicates homology |
U | K.LEYNYNSHNVYIMADKQK.N + Deamidated (NQ); Oxidation (M) | |
| 4407 |
813.4285 | 2437.2637 | 2437.2377 | 10.7 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
U | K.GEELFTGVVPILVELDGDVNGHK.F + Deamidated (NQ) | |
| 4451 |
895.6457 | 4473.1921 | 4473.1360 | 12.5 | 0 | 11 | 0.66 | 1Score > 22 indicates identity |
U | R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D + 2 Deamidated (NQ) |
| Score | Mass | Subset of | |||
|---|---|---|---|---|---|
| B7UCZ6_9RHAB |
562 | 85329 | 1.1 | ||
| G protein/GFP fusion protein OS=Recombinant vesicular stomatitis Indiana virus rVSV-G/GFP OX=582817 GN=G PE=3 SV=1 | |||||
| 1 sameset of B7UCZ6_9RHAB | |||||
| GFP_AEQVI |
562 | 26983 | |||
| Green fluorescent protein OS=Aequorea victoria GN=GFP PE=1 SV=1 | |||||
| Q2U8R9_ASPOR |
38 | 0 | 1.1 | ||
| description | |||||
| Q2UG34_ASPOR |
27 | 0 | 1.1 | ||
| description | |||||
| Q2UMK6_ASPOR |
23 | 0 | 1.1 | ||
| description | |||||
2| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | FHP_YEAST | 480 | Flavohemoprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHB1 PE=1 SV=2 |
3| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | TRYP_PIG | 195 | Trypsin OS=Sus scrofa PE=1 SV=1 |
4| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | Q2UU95_ASPOR | 191 | Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000405 PE=3 SV=1 |
5| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | Q2UHF6_ASPOR | 156 | Aldedh domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000467 PE=3 SV=1 |
6| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | Q2U480_ASPOR | 143 | eIF-5a domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000450 PE=4 SV=1 |
7| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | Q2U2R5_ASPOR | 140 | WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000349 PE=4 SV=1 |
8| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | Q2ULW0_ASPOR | 100 | Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000247 PE=4 SV=1 |
9| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | Q2UK92_ASPOR | 71 | AlcB domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000906 PE=4 SV=1 |
10| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | EF1A_ASPOR | 51 | Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=tef1 PE=3 SV=1 |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/